BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_O15 (600 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051510-1|AAK92934.1| 385|Drosophila melanogaster GH16429p pro... 142 3e-34 AE013599-609|AAF59120.2| 385|Drosophila melanogaster CG8707-PA ... 142 3e-34 BT003595-1|AAO39598.1| 494|Drosophila melanogaster GM20958p pro... 29 6.4 AE013599-1414|AAF58558.4| 494|Drosophila melanogaster CG33964-P... 29 6.4 >AY051510-1|AAK92934.1| 385|Drosophila melanogaster GH16429p protein. Length = 385 Score = 142 bits (344), Expect = 3e-34 Identities = 64/71 (90%), Positives = 69/71 (97%) Frame = +3 Query: 387 VRRSGKSSIQKVVFHKMSPNETLFLESTNKIVQDDIYNSSFVQFQIWDFPGQIDFFDPTF 566 +RRSGKSSIQKVVFHKMSPNETLFLEST+KIV+DDI NSSFVQFQIWDFPGQIDFF+PTF Sbjct: 48 MRRSGKSSIQKVVFHKMSPNETLFLESTSKIVKDDINNSSFVQFQIWDFPGQIDFFEPTF 107 Query: 567 DSDTMFGGCGA 599 DSD +FGGCGA Sbjct: 108 DSDMIFGGCGA 118 >AE013599-609|AAF59120.2| 385|Drosophila melanogaster CG8707-PA protein. Length = 385 Score = 142 bits (344), Expect = 3e-34 Identities = 64/71 (90%), Positives = 69/71 (97%) Frame = +3 Query: 387 VRRSGKSSIQKVVFHKMSPNETLFLESTNKIVQDDIYNSSFVQFQIWDFPGQIDFFDPTF 566 +RRSGKSSIQKVVFHKMSPNETLFLEST+KIV+DDI NSSFVQFQIWDFPGQIDFF+PTF Sbjct: 48 MRRSGKSSIQKVVFHKMSPNETLFLESTSKIVKDDINNSSFVQFQIWDFPGQIDFFEPTF 107 Query: 567 DSDTMFGGCGA 599 DSD +FGGCGA Sbjct: 108 DSDMIFGGCGA 118 >BT003595-1|AAO39598.1| 494|Drosophila melanogaster GM20958p protein. Length = 494 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 370 ILLNGRLDGLASHQYKKWSFIRCHQMKH 453 + L RLDGL + W F+ CH + + Sbjct: 7 VQLQRRLDGLLAFLNPHWDFVNCHMVNY 34 >AE013599-1414|AAF58558.4| 494|Drosophila melanogaster CG33964-PA, isoform A protein. Length = 494 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 370 ILLNGRLDGLASHQYKKWSFIRCHQMKH 453 + L RLDGL + W F+ CH + + Sbjct: 7 VQLQRRLDGLLAFLNPHWDFVNCHMVNY 34 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,630,177 Number of Sequences: 53049 Number of extensions: 394146 Number of successful extensions: 864 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2441585082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -