BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_O15 (600 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 25 0.75 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 4.0 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 24.6 bits (51), Expect = 0.75 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 595 PHPPNIVSESNVGSKKSICPGKSHI*NCTKLLL 497 PH P +V+ G + ICPGK + +L+L Sbjct: 450 PHSPLLVAPFGAGRR--ICPGKRFVDLALQLIL 480 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +2 Query: 272 TWVHFPKILATGRVNKTVIEITHLYKKDQQTSLFFL 379 T +H P+I+ ++ I L DQ + FF+ Sbjct: 138 TVIHQPRIIIIDLKTDKILRIYPLKSSDQTSDSFFV 173 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,203 Number of Sequences: 438 Number of extensions: 2873 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -