BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_O14 (515 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 30 0.011 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 30 0.011 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 30 0.011 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 6.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 6.5 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 30.3 bits (65), Expect = 0.011 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 306 PVHSISYITGLWVTLTHSSIT 368 P+H+ SY+TG+WV L + S T Sbjct: 122 PIHTSSYMTGIWVWLINISAT 142 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 30.3 bits (65), Expect = 0.011 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 306 PVHSISYITGLWVTLTHSSIT 368 P+H+ SY+TG+WV L + S T Sbjct: 355 PIHTSSYMTGIWVWLINISAT 375 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 30.3 bits (65), Expect = 0.011 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 306 PVHSISYITGLWVTLTHSSIT 368 P+H+ SY+TG+WV L + S T Sbjct: 355 PIHTSSYMTGIWVWLINISAT 375 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.0 bits (42), Expect = 6.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 470 IKLAIVKECDYFLNDNIIEFNRRRNEVSLEDK 375 IKL + KE + L+D+ E ++ E +DK Sbjct: 211 IKLVVEKEREKELSDDEAEEEKKEEEGEDKDK 242 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.0 bits (42), Expect = 6.5 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +1 Query: 223 LGAATVNHSTSTPSCPVRLTFTKPRLRDPC 312 LG+ + H V L ++P+L PC Sbjct: 9 LGSMDIKHEMIYREDDVLLVKSEPQLHSPC 38 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,210 Number of Sequences: 336 Number of extensions: 1766 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -