BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_O14 (515 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79605-8|CAE18060.2| 340|Caenorhabditis elegans Hypothetical pr... 27 8.0 AL034489-11|CAL49453.1| 340|Caenorhabditis elegans Hypothetical... 27 8.0 >Z79605-8|CAE18060.2| 340|Caenorhabditis elegans Hypothetical protein ZK678.8 protein. Length = 340 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 234 HRKPFDKHTFMPSALDFYQTATSRPVHSISYITGLW 341 H + FDKH+F + YQ + HS Y+ LW Sbjct: 302 HNEGFDKHSFDDFVVYHYQYSR----HSAKYLESLW 333 >AL034489-11|CAL49453.1| 340|Caenorhabditis elegans Hypothetical protein ZK678.8 protein. Length = 340 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 234 HRKPFDKHTFMPSALDFYQTATSRPVHSISYITGLW 341 H + FDKH+F + YQ + HS Y+ LW Sbjct: 302 HNEGFDKHSFDDFVVYHYQYSR----HSAKYLESLW 333 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,762,693 Number of Sequences: 27780 Number of extensions: 170636 Number of successful extensions: 452 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -