BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_O07 (662 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 23 1.7 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 2.2 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 359 ASPCPSKEVTVLFPTPPFPESTS 291 A+P P+ +T L+P+P STS Sbjct: 311 ATPTPTSVMTELYPSPVPGHSTS 333 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.0 bits (47), Expect = 2.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 461 ELCTCSPRTPSTRG 420 EL TC+PR P G Sbjct: 97 ELATCTPREPGVAG 110 Score = 21.8 bits (44), Expect = 5.2 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = -2 Query: 493 PLHIQETSPSQSYVLAPRGHRVHGAGSDHIYLHP 392 P H +P+ ++V+ V D IY HP Sbjct: 51 PYHANHVNPTANHVMGGAVPDVGKRDKDAIYGHP 84 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,703 Number of Sequences: 336 Number of extensions: 4765 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -