BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_O02 (414 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) 195 1e-50 SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) 147 3e-36 SB_39426| Best HMM Match : C4 (HMM E-Value=0) 104 3e-23 SB_5177| Best HMM Match : C4 (HMM E-Value=1.4e-32) 100 9e-22 SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.070 SB_7057| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.28 SB_41466| Best HMM Match : Collagen (HMM E-Value=9.2) 31 0.28 SB_10009| Best HMM Match : CPL (HMM E-Value=2.5) 31 0.28 SB_52940| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.50 SB_42074| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.50 SB_14703| Best HMM Match : Borrelia_orfA (HMM E-Value=0.14) 31 0.50 SB_10559| Best HMM Match : HAT (HMM E-Value=2) 31 0.50 SB_4799| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.50 SB_52937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.66 SB_43056| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.87 SB_26852| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.87 SB_43233| Best HMM Match : Caudal_act (HMM E-Value=5.7) 29 1.1 SB_36452| Best HMM Match : Collagen (HMM E-Value=0.35) 29 1.1 SB_36287| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) 28 3.5 SB_19442| Best HMM Match : Beach (HMM E-Value=0) 28 3.5 SB_18418| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 >SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1853 Score = 195 bits (476), Expect = 1e-50 Identities = 81/127 (63%), Positives = 100/127 (78%) Frame = +2 Query: 8 VPQCEPGHVKLWDGYSLLYIDGNEKAHNQDLGYAGSCVRKFSTMPFLFCDLNDVCNYASR 187 VP+C LW+GYSLLY+ GNE+AH QDLG GSC+++FSTMPFLFC++N+VCN ASR Sbjct: 1586 VPRCPEDRPPLWEGYSLLYVQGNERAHGQDLGSPGSCIQRFSTMPFLFCNINNVCNLASR 1645 Query: 188 NDRSYWLSTGQPIPMMPV*GNEIVTYISRCVVCEVPSNVIAVHSQTLDIPGCPVGWSELW 367 ND S+WLST +PIPMMPV + YI RC VCEV S+V+AVHSQ++ +P CP GWS LW Sbjct: 1646 NDYSFWLSTPEPIPMMPVQETNVQPYIGRCAVCEVSSHVMAVHSQSITVPSCPSGWSPLW 1705 Query: 368 IGYSFVM 388 GYSF+M Sbjct: 1706 QGYSFLM 1712 Score = 84.2 bits (199), Expect = 4e-17 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +2 Query: 254 IVTYISRCVVCEVPSNVIAVHSQTLDIPGCPVGWSELWIGYSFVMHTGAGGQG 412 ++ YI RC VCEV S+V+AVHSQ++ +P CP GWS LW GYSF+MHT AG G Sbjct: 1711 LMPYIGRCAVCEVSSHVMAVHSQSITVPSCPSGWSPLWQGYSFLMHTSAGNDG 1763 Score = 51.6 bits (118), Expect = 2e-07 Identities = 34/102 (33%), Positives = 45/102 (44%), Gaps = 8/102 (7%) Frame = +2 Query: 8 VPQCEPGHVKLWDGYS-LLYIDGNEKAHNQDLGYAGSCVRKFSTMPFLFCDLNDVCNYAS 184 VP C G LW GYS L++ Q L GSC+ F PF+ C C+Y Sbjct: 1737 VPSCPSGWSPLWQGYSFLMHTSAGNDGSGQLLSSPGSCLEDFRAHPFIECHGRGTCHYYG 1796 Query: 185 RNDRSYWLSTGQ-------PIPMMPV*GNEIVTYISRCVVCE 289 + S+WL+T P P GN + +SRC VC+ Sbjct: 1797 -STYSFWLATVDQNKQFRIPRPETLKAGN-LRERVSRCQVCQ 1836 Score = 31.5 bits (68), Expect = 0.28 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 314 HSQTLDIPGCPVGWSELWIGYSFVMHTG 397 HSQT+ +P CP LW GYS + G Sbjct: 1580 HSQTVRVPRCPEDRPPLWEGYSLLYVQG 1607 >SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1705 Score = 147 bits (357), Expect = 3e-36 Identities = 60/104 (57%), Positives = 80/104 (76%) Frame = +2 Query: 11 PQCEPGHVKLWDGYSLLYIDGNEKAHNQDLGYAGSCVRKFSTMPFLFCDLNDVCNYASRN 190 P+C P + KLWDGYSLLY+ G++ +H QDLG AGSC+++F+TMP+L+C++ CNYASRN Sbjct: 1473 PECPPTYDKLWDGYSLLYVQGHDVSHGQDLGQAGSCLKRFTTMPYLYCNIFGKCNYASRN 1532 Query: 191 DRSYWLSTGQPIPMMPV*GNEIVTYISRCVVCEVPSNVIAVHSQ 322 D SYWLST +PMMP+ + + YISRC VCE V+AVHS+ Sbjct: 1533 DYSYWLSTDNQVPMMPIQASAVEPYISRCTVCESHGPVMAVHSK 1576 Score = 41.1 bits (92), Expect = 4e-04 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = +2 Query: 92 QDLGYAGSCVRKFSTMPFLFCDLNDVCNYASRNDRSYWLST-GQPIPMM---PV*GNEIV 259 Q LG +GSC+ F PF C C+Y + N S+WL+T P + ++ Sbjct: 1592 QSLGSSGSCLESFRPNPFTECHGRGTCHYYA-NKYSFWLATVNTPFQTQQSETLKAGNLL 1650 Query: 260 TYISRCVVC 286 + +SRC VC Sbjct: 1651 SRVSRCQVC 1659 Score = 32.3 bits (70), Expect = 0.16 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 305 IAVHSQTLDIPGCPVGWSELWIGYSFVMHTG 397 I HSQT P CP + +LW GYS + G Sbjct: 1463 IVKHSQTTTPPECPPTYDKLWDGYSLLYVQG 1493 >SB_39426| Best HMM Match : C4 (HMM E-Value=0) Length = 188 Score = 104 bits (249), Expect = 3e-23 Identities = 43/71 (60%), Positives = 51/71 (71%) Frame = +2 Query: 200 YWLSTGQPIPMMPV*GNEIVTYISRCVVCEVPSNVIAVHSQTLDIPGCPVGWSELWIGYS 379 YWLST +PMMP+ + + YISRC VCE V+AVHSQ+ +P CP GWS LW GYS Sbjct: 2 YWLSTDNQVPMMPIQASAVEPYISRCTVCESHGPVMAVHSQSTTLPTCPGGWSSLWSGYS 61 Query: 380 FVMHTGAGGQG 412 F+MHTGAGG G Sbjct: 62 FLMHTGAGGSG 72 Score = 57.6 bits (133), Expect = 4e-09 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 5/98 (5%) Frame = +2 Query: 8 VPQCEPGHVKLWDGYS-LLYIDGNEKAHNQDLGYAGSCVRKFSTMPFLFCDLNDVCNYAS 184 +P C G LW GYS L++ Q LG +GSC+ F PF+ C C+Y + Sbjct: 46 LPTCPGGWSSLWSGYSFLMHTGAGGSGTGQSLGSSGSCLESFRPNPFIECHGRGTCHYYA 105 Query: 185 RNDRSYWLST-GQPIPMM---PV*GNEIVTYISRCVVC 286 N S+WL+T P + +++ +SRC VC Sbjct: 106 -NKYSFWLATVNTPFQTQQSETLKAGNLLSRVSRCQVC 142 >SB_5177| Best HMM Match : C4 (HMM E-Value=1.4e-32) Length = 176 Score = 99.5 bits (237), Expect = 9e-22 Identities = 38/64 (59%), Positives = 53/64 (82%) Frame = +2 Query: 11 PQCEPGHVKLWDGYSLLYIDGNEKAHNQDLGYAGSCVRKFSTMPFLFCDLNDVCNYASRN 190 P+C P + KLWDGYSLLY+ G++ +H QDLG AGSC+++F+TMP+L+C++ CNYASRN Sbjct: 77 PECPPTYDKLWDGYSLLYVQGHDVSHGQDLGQAGSCLKRFTTMPYLYCNIFGKCNYASRN 136 Query: 191 DRSY 202 D S+ Sbjct: 137 DYSH 140 Score = 32.3 bits (70), Expect = 0.16 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 305 IAVHSQTLDIPGCPVGWSELWIGYSFVMHTG 397 I HSQT P CP + +LW GYS + G Sbjct: 67 IVKHSQTTTPPECPPTYDKLWDGYSLLYVQG 97 >SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 33.5 bits (73), Expect = 0.070 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +2 Query: 245 GNEIVTYISRCVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMH 391 GN + + C VC VPS S L IP CP GWS + GY H Sbjct: 55 GNSLQDHDVPCAVCYVPSR-----STQLMIPAVARCPAGWSREYYGYLMTEH 101 Score = 30.7 bits (66), Expect = 0.50 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMHTG 397 C VC VPS S L IP CP GWS + GY + G Sbjct: 425 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGYLMTSYYG 463 >SB_7057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 31.5 bits (68), Expect = 0.28 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPGCPVGWSELWIGYSFVMHTG 397 C VC VPS + + CP GWS + GY + G Sbjct: 112 CAVCYVPSR--STQLMIPSVARCPTGWSREYYGYLIASYYG 150 >SB_41466| Best HMM Match : Collagen (HMM E-Value=9.2) Length = 288 Score = 31.5 bits (68), Expect = 0.28 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMH 391 C VC VPS S L IP CP GWS + GY H Sbjct: 151 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGYLMTSH 187 >SB_10009| Best HMM Match : CPL (HMM E-Value=2.5) Length = 321 Score = 31.5 bits (68), Expect = 0.28 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMHTG 397 C VC V S S L IPG CP GWS + GY H G Sbjct: 225 CAVCYVSSR-----SAKLLIPGTNVCPAGWSREYHGYLMTAHRG 263 >SB_52940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 30.7 bits (66), Expect = 0.50 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMHTG 397 C VC VPS S L IP CP GWS + GY + G Sbjct: 77 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGYLMTKYHG 115 >SB_42074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 30.7 bits (66), Expect = 0.50 Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Frame = +2 Query: 245 GNEIVTYISRCVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMHTG 397 G + + C VC VPS S L IP CP GWS + GY + G Sbjct: 79 GKSLQNHDVPCAVCYVPSR-----STQLMIPAVARCPAGWSREYYGYLMTEYYG 127 >SB_14703| Best HMM Match : Borrelia_orfA (HMM E-Value=0.14) Length = 558 Score = 30.7 bits (66), Expect = 0.50 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMHTG 397 C VC VPS S L IP CP GWS + GY + G Sbjct: 84 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGYLMTSYYG 122 >SB_10559| Best HMM Match : HAT (HMM E-Value=2) Length = 123 Score = 30.7 bits (66), Expect = 0.50 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -3 Query: 391 MHDKTVTNPQFTPSYWATWN 332 MH +++P+ TPS+W TW+ Sbjct: 23 MHASQISDPRRTPSFWKTWH 42 >SB_4799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1098 Score = 30.7 bits (66), Expect = 0.50 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMHTG 397 C VC VPS S L IP CP GWS + GY + G Sbjct: 701 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGYLMTSYYG 739 Score = 29.9 bits (64), Expect = 0.87 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMHTG 397 C VC VPS S L IP CP GWS + GY + G Sbjct: 82 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGYLMTDYYG 120 >SB_52937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 340 Score = 30.3 bits (65), Expect = 0.66 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMHTG 397 C VC VPS S L IP CP GWS + GY + G Sbjct: 125 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGYLMTEYYG 163 >SB_43056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 0.87 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMHTG 397 C VC VPS S L IP CP GWS + GY + G Sbjct: 53 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGYLMTDYYG 91 >SB_26852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 29.9 bits (64), Expect = 0.87 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGYSFVMHTG 397 C VC VPS S L IP CP GWS + GY + G Sbjct: 198 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGYLMTDYYG 236 >SB_43233| Best HMM Match : Caudal_act (HMM E-Value=5.7) Length = 118 Score = 29.5 bits (63), Expect = 1.1 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGY 376 C VC VPS S L IP CP GWS + GY Sbjct: 65 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGY 96 >SB_36452| Best HMM Match : Collagen (HMM E-Value=0.35) Length = 374 Score = 29.5 bits (63), Expect = 1.1 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGY 376 C VC VPS S L IP CP GWS + GY Sbjct: 99 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGY 130 >SB_36287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 29.5 bits (63), Expect = 1.1 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +2 Query: 275 CVVCEVPSNVIAVHSQTLDIPG---CPVGWSELWIGY 376 C VC VPS S L IP CP GWS + GY Sbjct: 65 CAVCYVPSR-----STQLMIPAVARCPAGWSREYYGY 96 >SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) Length = 2996 Score = 27.9 bits (59), Expect = 3.5 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -3 Query: 352 SYWA-TWNV*CLAVDSYNIRWHFAYNTSRNVCYYLISLHRH 233 +YW +W + CL++ + + W+ A N S + ++L++L H Sbjct: 2252 TYWTISWLI-CLSMVTLSWIWNLAANVSNLLDHFLVNLSEH 2291 >SB_19442| Best HMM Match : Beach (HMM E-Value=0) Length = 796 Score = 27.9 bits (59), Expect = 3.5 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +2 Query: 62 YIDGNEKAHNQDLGYAGSCVRKFSTMPFLFCDLNDVCNYASRNDRSYWLSTGQ 220 Y D + K + + G +G S PFL C L+ C A R S L T + Sbjct: 364 YWDNSFKCFSTESGQSGCTRIATSPQPFLSCSLSFACLLAHRASVSLDLDTSK 416 >SB_18418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 27.5 bits (58), Expect = 4.6 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 162 LRSQKRNGIVLNFRTHEPAYPRSWLCAFSFPSIY 61 +R R I++ R+ A SW+ +F FPSIY Sbjct: 127 VRPPHRGQILVTKRSVALAISSSWIFSFMFPSIY 160 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,555,981 Number of Sequences: 59808 Number of extensions: 301792 Number of successful extensions: 665 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 764823134 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -