BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_N12 (210 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 23 0.98 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 23 1.7 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 22 2.3 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 22 3.0 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 22 3.0 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 21 4.0 AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding pr... 21 5.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 21 5.2 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 21 6.9 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 21 6.9 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 20 9.1 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.4 bits (48), Expect = 0.98 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 63 YSYNIDNISLVGAPLC 16 Y+Y + + L G+PLC Sbjct: 899 YAYQLHRMQLTGSPLC 914 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 22.6 bits (46), Expect = 1.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 144 TVDDFPLCVHLVSDEYEQL 200 T + P +HL+ +EY++L Sbjct: 84 TCETLPSEIHLIKEEYDEL 102 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 22.2 bits (45), Expect = 2.3 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 105 PKIRIFDLGKKRATVD 152 P I +++ KKRAT+D Sbjct: 1103 PDILVYEKRKKRATID 1118 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 21.8 bits (44), Expect = 3.0 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 190 YSSDTKCTHSGKSST 146 Y+S TK TH+ KS T Sbjct: 474 YNSKTKSTHTPKSIT 488 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 21.8 bits (44), Expect = 3.0 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = +1 Query: 94 VCLTQRSVFSTWAKRERQWMTSH 162 +CLT+R + + R +W H Sbjct: 317 LCLTERQIKIWFQNRRMKWKKEH 339 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 21.4 bits (43), Expect = 4.0 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -2 Query: 101 RHTPTKPRFRIRFILTISITSRWSAP 24 R TP+ PR + +S WS P Sbjct: 48 RSTPSSPRLAQASTCPVPCSSIWSRP 73 >AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding protein AgamOBP8 protein. Length = 176 Score = 21.0 bits (42), Expect = 5.2 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 56 TISITSRWSAPHCVLHKA 3 T + SRW C+L KA Sbjct: 90 TDNADSRWCIVRCILQKA 107 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 21.0 bits (42), Expect = 5.2 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = -3 Query: 187 SSDTKCTHSGKSSTVALFLPKSKIRIFGSGTPRQNRDLG 71 SS CT S S L PK + + T NRD G Sbjct: 3025 SSTGICTSSDTLSQQTLQAPKGESLSSSTTTTTNNRDGG 3063 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 20.6 bits (41), Expect = 6.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 18 TMGRRPARCY 47 T+GR+P CY Sbjct: 294 TLGRKPETCY 303 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 20.6 bits (41), Expect = 6.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 208 SELSCSYSSDTKC 170 S L C+Y+ TKC Sbjct: 10 SVLGCAYTQRTKC 22 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 20.2 bits (40), Expect = 9.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 126 LGKKRATVDDFPLCVHLVSDE 188 L R TVD + HL+SD+ Sbjct: 992 LPSSRITVDRSTIARHLLSDQ 1012 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 239,177 Number of Sequences: 2352 Number of extensions: 4118 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 47 effective length of database: 453,435 effective search space used: 9975570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -