BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_N10 (597 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) 42 3e-04 SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) 42 4e-04 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 42 5e-04 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 42 5e-04 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 39 0.004 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 38 0.008 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 38 0.008 SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) 38 0.008 SB_15403| Best HMM Match : CH (HMM E-Value=0) 38 0.008 SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) 37 0.011 SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 36 0.025 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 35 0.043 SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) 35 0.057 SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) 35 0.057 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 34 0.10 SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) 33 0.13 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 33 0.23 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 32 0.31 SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) 29 2.9 SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) 28 5.0 SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) 28 5.0 SB_33373| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_21821| Best HMM Match : MRG (HMM E-Value=0) 28 6.6 SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) 27 8.7 SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) 27 8.7 >SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) Length = 77 Score = 42.3 bits (95), Expect = 3e-04 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +1 Query: 370 KCAEN-CISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLARQAPCP 513 KC ++ + T +Y+PVCGSD KTY N L A C + + + CP Sbjct: 24 KCDDSPTLCTLQYDPVCGSDGKTYGNMCFLKAAIKCNPDLYMKHKGACP 72 >SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) Length = 143 Score = 41.9 bits (94), Expect = 4e-04 Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLA--RQAPCPSSSK 525 C ENC ST + PVCG+DN TY N+ L Q C T+A R+ C SK Sbjct: 27 CPENCSSTVD--PVCGTDNNTYDNEC-LMRQQACVANATVAVRRKGHCDPCSK 76 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARL 456 C E C T PV G+DNK Y N+ L Sbjct: 98 CVEPCPKT--LKPVYGTDNKNYDNECLL 123 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 41.9 bits (94), Expect = 4e-04 Identities = 23/47 (48%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARL-FCAQNCGVQVTLARQAPC 510 C +NC ST + PVCGSD KTYKN+ L A VT+A Q C Sbjct: 3970 CNKNCPSTSK--PVCGSDGKTYKNECELKRAACESKKNVTVASQGEC 4014 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKN 444 +C C+ P+ PVCG+D KTY+N Sbjct: 4236 ECPSRCL--PDKEPVCGADGKTYRN 4258 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 41.5 bits (93), Expect = 5e-04 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNC--GVQVTLARQAPCP 513 +C + C T EY P CG+D TY N+ + Q+C G ++ LA PCP Sbjct: 278 ECPKAC--TREYKPACGTDGNTYPNRC-VLAIQSCETGEKLQLAHDGPCP 324 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARL---FCAQNCGVQVTLARQAPCP 513 +C + C T +Y PVCGSDNKTY N L C ++ L PCP Sbjct: 195 ECPKVC--TLDYTPVCGSDNKTYANLCNLEVEACKPENTDKLQLLHDGPCP 243 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +1 Query: 358 QTIEKCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNC--GVQVTLARQAPCPSSS 522 Q + C E C T EY PVCGSD KTY N L ++C ++++ ++ C S+ Sbjct: 37 QPVCVCNEAC--TREYAPVCGSDGKTYPNPCALE-VESCKTNTRISVIKKGSCDDSA 90 Score = 37.9 bits (84), Expect = 0.006 Identities = 20/49 (40%), Positives = 25/49 (51%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLARQAPCPS 516 +C C T E PVCG+D KTY N L A + LA + PCP+ Sbjct: 117 ECPRAC--TRELMPVCGTDQKTYDNMCLLERAACKDDGLMLAHEGPCPT 163 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 41.5 bits (93), Expect = 5e-04 Identities = 24/56 (42%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLARQ-----APCPSSSK 525 C ENC ST + PVCG+DN TY N+ L Q C T+A + PCP + K Sbjct: 161 CPENCSSTVD--PVCGTDNNTYDNEC-LMRQQACVANATVAVRRKGHCEPCPKTLK 213 Score = 41.1 bits (92), Expect = 7e-04 Identities = 23/48 (47%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLA--RQAPC 510 C ENC ST + PVCGSDN TY N+ L Q C T+A R+ C Sbjct: 275 CPENCSSTVD--PVCGSDNNTYDNEC-LMRQQACVANTTVAVRRKGDC 319 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARL---FCAQNCGVQVT-LARQAPC 510 C E C T PV G+DNK Y N+ L C N + + R PC Sbjct: 90 CVEPCPKT--LKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFGRYNPC 137 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 41.5 bits (93), Expect = 5e-04 Identities = 24/52 (46%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLA--RQAPCPSSS 522 C ENC ST + PVCGSDN TY N+ L Q C T+A R+ C S Sbjct: 1206 CPENCSSTVD--PVCGSDNNTYDNEC-LMRQQACVANTTVAVRRKGDCDPCS 1254 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARL---FCAQNCGVQVTLARQAPCPSSSK 525 C +C P+CGS+NKTY N+ L C N + + ++ P P K Sbjct: 289 CPSSCGDESLPQPICGSNNKTYANECELRMDSCKNNKSIAIQFRKECPAPCQGK 342 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLA 495 C ENC ST + PVCG+DN TY N+ L Q C T+A Sbjct: 1135 CPENCSSTVD--PVCGTDNNTYDNEC-LMRQQACVANATVA 1172 Score = 37.1 bits (82), Expect = 0.011 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQA---RLFCAQNCGVQVTLARQAPC 510 C ++C T E P+C SD +TY N+ + C N + VT R PC Sbjct: 2154 CPDDC--TNETKPICASDGQTYDNECLMQKRACENNQNLNVTSDRACPC 2200 Score = 34.7 bits (76), Expect = 0.057 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTL 492 +C+E+C T PVCGSDN Y N+ L A+ C T+ Sbjct: 1372 ECSEDCPKT--LKPVCGSDNNDYDNEC-LMQARACATNKTI 1409 Score = 33.9 bits (74), Expect = 0.10 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +1 Query: 385 CISTPEYN-PVCGSDNKTYKNQARL---FCAQNCGVQVTLARQAPCP 513 C P+ + PVCG++NKTY ++ L C N + V L + PCP Sbjct: 679 CPECPQVDKPVCGTNNKTYTSECALQVDACKTNTSIDVQLDK--PCP 723 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +1 Query: 406 NPVCGSDNKTYKNQARL---FCAQNCGVQVTLARQAPCPSSSK 525 +PVCGSD+KTY N+ R+ C N + +A+Q C +K Sbjct: 617 DPVCGSDSKTYPNECRMRQEACWNN--KWIIVAQQEECDPCNK 657 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARL---FCAQNCGVQVT-LARQAPC 510 C E C T PV G+DNK Y N+ L C N + + R PC Sbjct: 1064 CVEPCPKT--LKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFGRYNPC 1111 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARL--FCAQNCGVQVTLARQAPC 510 C + C T +PVC SDN TY N+ + Q+ V +T R+ C Sbjct: 1580 CPKICPIT--LDPVCASDNNTYPNECAMKQLACQSAKV-LTFRRKGDC 1624 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 406 NPVCGSDNKTYKNQARL 456 +PVCGSDN TY ++ +L Sbjct: 227 DPVCGSDNVTYASECQL 243 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 397 PEYNPVCGSDNKTYKNQARLF-CAQNCGVQVTLARQAPC 510 P PVCGSD TY+++ + A +TL C Sbjct: 2631 PTLTPVCGSDGVTYESECGMIQKACQTNTSITLVANEAC 2669 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARL 456 C E C T PV G+DNK Y N+ L Sbjct: 1277 CVEPCPKT--LKPVYGTDNKNYDNECLL 1302 >SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +1 Query: 385 CISTPEYN-PVCGSDNKTYKNQARL-FCAQNCGVQVTLARQAPC 510 C+S P+ N PVCGS+ K Y N+ L A +T+AR++PC Sbjct: 205 CMSCPKMNKPVCGSNGKDYNNECELQQFACKTNTMITVARRSPC 248 Score = 34.7 bits (76), Expect = 0.057 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +1 Query: 385 CISTPEY-NPVCGSDNKTYKNQARL-FCAQNCGVQVTLARQAPCPSSSK 525 C+S P +PVCGSD K Y N+ L A +T+ R+ C S+++ Sbjct: 111 CLSCPNILDPVCGSDGKNYDNECNLRQNACKTNTLITVVRRDACLSTAR 159 Score = 33.1 bits (72), Expect = 0.18 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 385 CISTPEY-NPVCGSDNKTYKNQARL-FCAQNCGVQVTLARQAPCP 513 C+S P +PVCGSD K Y N +L A +TL + CP Sbjct: 274 CLSCPNMLDPVCGSDGKNYDNVCKLRQNACKTNTLITLISRDACP 318 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQA---RLFCAQNCGVQVTLARQAPC 510 C+ I T EY+P+CGSD KTY NQ R C QN + + PC Sbjct: 5152 CSCPDICTFEYSPLCGSDGKTYDNQCEMERASCLQNKDLTGKPGKCDPC 5200 Score = 35.5 bits (78), Expect = 0.033 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARL---FCAQNCGVQVTLARQAPC 510 C N I T EY PVCG+D ++Y N+ L C +N ++V A Q C Sbjct: 5222 CTCNSICTLEYAPVCGTDGQSYDNECLLQTASCQRNELIEV--ATQGTC 5268 Score = 35.5 bits (78), Expect = 0.033 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +1 Query: 385 CISTPEY-NPVCGSDNKTYKNQARL-FCAQNCGVQVTLARQAPCP 513 C+S P +PVCGSD K Y N+ L A +T+ R+ CP Sbjct: 5790 CLSCPNILDPVCGSDGKNYDNECNLRQNACKTNTLITVVRRDACP 5834 Score = 34.3 bits (75), Expect = 0.076 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +1 Query: 385 CISTPEYN-PVCGSDNKTYKNQARL 456 C S P N PVCGSD KTY N+ L Sbjct: 5621 CQSCPSINKPVCGSDGKTYNNECEL 5645 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +1 Query: 400 EYNPVCGSDNKTYKNQARL---FCAQNCGVQVTLARQAPC 510 +Y PVCG+D +TY+N+ L C +N QV +A Q C Sbjct: 5558 DYTPVCGTDGETYENECTLQISSCQRN--EQVEVASQGHC 5595 Score = 31.1 bits (67), Expect = 0.71 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARL---FCAQNCGVQVTLARQAPCPSS 519 +C + I + Y PVCG+D + Y N+ L C +N ++V A + CP++ Sbjct: 5292 ECVCDGICSLVYAPVCGTDGQEYSNECNLQIASCRKNELIEV--ASRGSCPTT 5342 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 37.5 bits (83), Expect = 0.008 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 367 EKCAENCISTPEYNPVCGSDNKTYKNQARLFCAQ-NCGVQVTLARQAPCPSS 519 +KCA C Y PVCGSDN TY N L A +T+ + C SS Sbjct: 167 DKCAPIC--NKMYQPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSS 216 Score = 35.9 bits (79), Expect = 0.025 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQA--RLFCAQNCGVQVTLARQAPCPS 516 +C C T E NPVCGSD KTY N ++ Q G Q+ L + C S Sbjct: 117 RCMRRC--TKELNPVCGSDGKTYDNPCVFKIAVCQMNG-QLRLKHRGACGS 164 Score = 33.1 bits (72), Expect = 0.18 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 364 IEKCAENCISTPEYNPVCGSDNKTYKNQARLFCAQ-NCGVQVTLARQAPC 510 ++ C C + Y PVCG+D KTY N+ L A +TLA C Sbjct: 41 VDPCVRPCPAI--YMPVCGTDGKTYGNKCMLGAATCRSNGTITLAYPGEC 88 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 37.5 bits (83), Expect = 0.008 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 367 EKCAENCISTPEYNPVCGSDNKTYKNQARLFCAQ-NCGVQVTLARQAPCPSS 519 +KCA C Y PVCGSDN TY N L A +T+ + C SS Sbjct: 24 DKCAPIC--NKMYQPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSS 73 >SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) Length = 87 Score = 37.5 bits (83), Expect = 0.008 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +1 Query: 382 NCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLARQ-----APCPSSSK 525 NC ST + PVCGSDN TY N+ L Q C T+A + PCP + K Sbjct: 2 NCSSTVD--PVCGSDNNTYDNEC-LMRQQACVANTTVAVRRKGDCEPCPKTLK 51 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 37.5 bits (83), Expect = 0.008 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLARQ--APCPSSS 522 KC + T EY PVCGSD TY N L A C Q + R C S+S Sbjct: 721 KCVCSAACTREYAPVCGSDGNTYNNLC-LLTAARCQSQTFIYRAHFGTCGSTS 772 Score = 37.5 bits (83), Expect = 0.008 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLAR--QAPC 510 +C + P Y+P+CG+D KTY N L A C Q ++ R + PC Sbjct: 1232 RCECDLRPDPAYDPICGTDGKTYNNDKDLESAA-CAQQTSIVRWHKGPC 1279 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARL 456 +C +C S Y PVCG D +TY N+ L Sbjct: 972 ECPRSCPSV-NY-PVCGDDGQTYDNECLL 998 >SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) Length = 92 Score = 37.1 bits (82), Expect = 0.011 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +1 Query: 364 IEKCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQ--VTLARQAPCPSS 519 I +C N T Y PVCG+D KTY N+ L A C + V LA + C S+ Sbjct: 34 IVRCVCNRACTKIYRPVCGTDGKTYGNKCVLEIA-TCESEGAVQLAHEGECDSA 86 >SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 36.3 bits (80), Expect = 0.019 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +1 Query: 394 TPEYNPVCGSDNKTYKNQARL 456 T +YNPVCGSD +TY N+A + Sbjct: 15 TADYNPVCGSDGRTYPNRASM 35 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 35.9 bits (79), Expect = 0.025 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 409 PVCGSDNKTYKNQARLFCAQ-NCGVQVTLARQAPCPSS 519 PVCGSD KTY N+ + A +T++ PCP + Sbjct: 1078 PVCGSDGKTYNNECLMRAASCKANKNITVSSYFPCPET 1115 Score = 31.5 bits (68), Expect = 0.53 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +1 Query: 385 CISTPEYN-PVCGSDNKTYKNQARLFCAQNC--GVQVTLARQAPCP 513 C S P N PVCGSD Y ++ L Q C +T+ + PCP Sbjct: 285 CRSCPLINIPVCGSDGAQYDSECAL-QQQACQTDTDITVISEGPCP 329 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = +1 Query: 385 CISTPE----YNPVCGSDNKTYKNQARL-FCAQNCGVQVTLARQAPCPSSS 522 C+ P+ Y+PV GSD K Y N+ L A ++ LA + P++S Sbjct: 758 CVCPPKCEKVYDPVYGSDGKNYDNECELKRAACTSNRRIILAGRGRVPTTS 808 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = +1 Query: 385 CISTPE----YNPVCGSDNKTYKNQARL-FCAQNCGVQVTLARQAPCPSSS 522 C+ P+ Y+PV GSD K Y N+ L A ++ LA + P++S Sbjct: 877 CVCPPKCEKVYDPVYGSDGKNYDNECELKRAACTSNRRIILAGRGRVPTTS 927 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +1 Query: 382 NCISTPE----YNPVCGSDNKTYKNQARL-FCAQNCGVQVTLARQAPCPSSSK 525 +C+ P+ Y+PV GSD K Y N+ L A ++ LA + P++++ Sbjct: 1442 SCVCPPKCEKVYDPVYGSDGKNYDNECELKRAACTTNKRIILAGRGRVPTTTE 1494 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Frame = +1 Query: 385 CISTPE----YNPVCGSDNKTYKNQARL-FCAQNCGVQVTLARQAPCPSSSK 525 C+ P+ Y+PV GSD K Y N+ L A ++ LA + P++++ Sbjct: 355 CVCPPKCEKVYDPVYGSDGKNYDNECELKRAACTSNRRIILAGRGRVPTTTE 406 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = +1 Query: 385 CISTPE----YNPVCGSDNKTYKNQARL 456 C+ P+ Y+PV GSD K Y N+ L Sbjct: 437 CVCPPQCEKVYDPVYGSDGKNYDNECEL 464 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 4/29 (13%) Frame = +1 Query: 382 NCISTPE----YNPVCGSDNKTYKNQARL 456 +C+ P+ Y+PV GSD K Y N+ L Sbjct: 1524 SCVCPPKCEKVYDPVYGSDGKNYDNECEL 1552 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 35.9 bits (79), Expect = 0.025 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNC--GVQVTLARQAPCPSS 519 KC C T EY PVCG+D KTY N+ + A C VT+A C S+ Sbjct: 1294 KCPIFC--TYEYMPVCGTDGKTYGNKCEM-RASACLKSTMVTVAYPGECESN 1342 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQ----VTLARQAPCPSS 519 KC + + T +Y PVC SD KTY N+ + +N G + + + Q CP + Sbjct: 1522 KCRQ--MMTADYTPVCASDGKTYPNRMSM---ENAGCEKNMILRIVSQGECPKA 1570 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLARQA 504 +C ++T EY PVC SD K Y N+ + +N G + + +A Sbjct: 1966 ECVCRTVTTLEYRPVCASDGKIYPNRMTM---ENAGCEKNMVLRA 2007 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 412 VCGSDNKTYKNQARLF-CAQNCGVQVTLARQAPCPSSSK 525 VCGSD TY N+ L A +T+ Q PCP + K Sbjct: 1452 VCGSDRMTYSNECTLTQTACQESKNLTVVSQGPCPPNPK 1490 Score = 31.5 bits (68), Expect = 0.53 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARL 456 KC + I +P +PVCGSD K YK+ L Sbjct: 1753 KCPPS-ICSPVISPVCGSDGKIYKDDCEL 1780 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLARQAP 507 +C I Y+PVCGSD Y N+ + A C Q + P Sbjct: 1364 QCVCPSICPLHYSPVCGSDGNMYSNECAMRAAA-CKQQKMITPSLP 1408 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 403 YNPVCGSDNKTYKNQARLFCAQNC--GVQVTLARQAPCPSSSK 525 Y+PVC S+ KTY N+ + A C ++T+ Q C K Sbjct: 1604 YDPVCASNGKTYSNRCDM-DADACIRDTKLTVVSQGACAKLGK 1645 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 Query: 394 TPEYNPVCGSDNKTYKN 444 T +Y+PVC SD +TY N Sbjct: 1818 TADYSPVCASDGQTYPN 1834 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 35.1 bits (77), Expect = 0.043 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +1 Query: 394 TPEYNPVCGSDNKTYKNQA---RLFCAQNCGVQVTLARQAPCPSSS 522 T +Y PVCG D K+Y + RL C + GV + +A + CP S Sbjct: 1758 TLKYTPVCGDDGKSYLSTCMLKRLACLK--GVHIAIASKGRCPCKS 1801 Score = 34.7 bits (76), Expect = 0.057 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +1 Query: 355 RQTIEKCAENCISTPEYNPVCGSDNKTYKNQARLFC-AQNCGVQVTLARQAPCPSSS 522 RQ + C ++ PVCGSD +TY N RL G VT+ RQ C S Sbjct: 430 RQAVCACPRFEDCPRDFRPVCGSDLRTYVNLCRLQVEVCQTGRAVTVLRQGACDPCS 486 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = +1 Query: 400 EYNPVCGSDNKTYKNQARL---FCAQNCGVQV 486 E +PVCGSD KTY+N+ +L C N V++ Sbjct: 516 EASPVCGSDGKTYENECKLRVESCKANQNVRI 547 Score = 31.9 bits (69), Expect = 0.40 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +1 Query: 382 NCISTPEYNPVCGSDNKTYKNQARL---FCAQNCGVQVTLARQAPC 510 +C P+ PVCG+DNK Y N+ L CA N + + + + PC Sbjct: 816 SCDKMPD--PVCGTDNKEYANECLLNVAACAAN--IHLRVLNKGPC 857 Score = 31.5 bits (68), Expect = 0.53 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +1 Query: 403 YNPVCGSDNKTYKNQARL---FCAQNCGVQVTLARQAPCPSSS 522 Y+PVCGS+ KTY N L C +N +++ + C S++ Sbjct: 1830 YDPVCGSNRKTYLNFCSLTAEACKKNLPIKMAYKGRCCCASTT 1872 Score = 31.1 bits (67), Expect = 0.71 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFC-AQNCGVQVTLARQAPC 510 KC+ P PVCGSD K+Y ++ L A +++TL + C Sbjct: 1679 KCSCPIYCPPSGQPVCGSDGKSYGSECELRKEACEAKIKLTLVSKGKC 1726 Score = 30.7 bits (66), Expect = 0.93 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARL 456 C NC S +++PVCG D TY+N L Sbjct: 579 CPTNCPS--DWDPVCGDDGVTYQNLCHL 604 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +1 Query: 358 QTIEKCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTL 492 Q I C E C T ++ VCGS+ +TY N L + +C ++ T+ Sbjct: 1886 QAICVCDEKC--TFAFDAVCGSNGRTYINDC-LLRSDSCKLRKTI 1927 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQ--VTLARQAPC 510 C+ C Y PVCG+D +T+ N A L ++C ++ + +A PC Sbjct: 1538 CSSRCPLV--YKPVCGTDMETHIN-ACLLKLKSCQIESDLDVAYSGPC 1582 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARL---FCAQNCGVQVTLARQAPC 510 C E C T YN +CGSD +Y + + C QN +T+A C Sbjct: 1610 CPERCPLT--YNLICGSDGVSYLSACAMRATACQQN--RNITVAHHGAC 1654 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARL 456 C ++C + Y P+C S+ KT+ NQ L Sbjct: 1361 CTKSCPLS--YEPLCASNGKTFPNQCAL 1386 >SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) Length = 85 Score = 34.7 bits (76), Expect = 0.057 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 367 EKCAENCISTPEYNPVCGSDNKTYKNQARLFCAQ-NCGVQVTLARQAPC 510 +KCA C Y PVCGSDN TY N L A +T+ + C Sbjct: 38 DKCAPICPKI--YRPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKC 84 >SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) Length = 69 Score = 34.7 bits (76), Expect = 0.057 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 364 IEKCAENCISTPEYN-PVCGSDNKTYKNQARLFCAQ-NCGVQVTLARQAPC 510 ++KC C P N PVCG+D KTY N+ L A + +TLA C Sbjct: 21 VDKCVRPC---PAINDPVCGTDGKTYGNECMLGAATCHSNGTITLAYPGEC 68 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 33.9 bits (74), Expect = 0.10 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +1 Query: 358 QTIEKCAENCISTPEYNPVCGSDNKTYKNQARL---FCAQNCGVQV 486 Q + +C C T EY PVCGSD KTY + + C++N ++V Sbjct: 42 QPVCECPMAC--TREYAPVCGSDGKTYPTECVMQVDACSKNKDIKV 85 >SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) Length = 98 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 364 IEKCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQ--VTLARQAPC 510 I +C N Y+P+CG+D KTY N+ L A C + V LA + C Sbjct: 34 IARCVCNRACKKIYSPMCGTDGKTYGNKCMLEIA-TCESEGAVKLAHEGEC 83 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLARQAPC 510 +C E C S E +PVCG+D +TY ++ L A+ G +V + + C Sbjct: 205 RCHEPCPS--EASPVCGTDMRTYASRCHLQLAKCKGHKVKMIYKGRC 249 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 32.7 bits (71), Expect = 0.23 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = +1 Query: 409 PVCGSDNKTYKNQARLFCAQNCGV------QVTLARQAPC 510 PVCGSD KTY N L A+ C + Q+TL + PC Sbjct: 246 PVCGSDGKTYTNGCELATAK-CALPKGQKRQLTLKHRGPC 284 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 409 PVCGSDNKTYKNQARLFCAQNC 474 P+CG D KTY+N LF C Sbjct: 189 PICGEDEKTYRNLC-LFLVAKC 209 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTY-KNQARLFCAQNCGVQVTLARQAPC 510 C +C T Y+PVCG D TY N R+ A N + PC Sbjct: 252 CPSDCSHT--YSPVCGGDKTTYINNCTRIAAACNMKKDIPFNVNGPC 296 Score = 30.7 bits (66), Expect = 0.93 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +1 Query: 370 KCAENCISTPEYNPVCGSDNKTYKNQARLFCAQNCGVQVTLARQAP 507 +C C S E +PVCG D +TY + + A+ C Q ++A + P Sbjct: 802 ECNTECPS--EASPVCGQDGRTYSSTCAM-DARACQAQTSIAVKHP 844 >SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 30.7 bits (66), Expect = 0.93 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Frame = +1 Query: 370 KCAENCIST-PEY-NPVCGSDNKTYKNQA---RLFCAQNCGVQVTLARQAPC 510 K + C+S P++ PVCGSD TY N R+ C ++T+ + PC Sbjct: 76 KASCECLSECPDHIKPVCGSDGVTYPNHCELHRIACVHT--KKITIRSKGPC 125 >SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) Length = 68 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 373 CAENCISTPEYNPVCGSDNKTYKNQARLFCAQNC 474 C+ +C PVCGSD+ TY N L +NC Sbjct: 8 CSFSCDDGFHQTPVCGSDDVTYANACTL-DERNC 40 >SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 61 ALLILGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRP 195 A +I GF+ + C +RY Q+ N +N W+ S NRP Sbjct: 6 ATIIRGFLKFRIICEKVRYFTQLRACYN--PQQNKWDTSHTNNRP 48 >SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +1 Query: 364 IEKCAENCISTPEYNPVCGSDNKTYKNQARLFCAQ-NCGVQVTLARQAPCPSSS 522 + C+ +C S+P VCG+D TY + RL A G + +A C S Sbjct: 128 VSNCS-SCNSSPADTEVCGADGVTYGSLCRLRVATCKLGKTIGVAYLGSCKEGS 180 >SB_17430| Best HMM Match : Kazal_1 (HMM E-Value=1e-07) Length = 396 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +1 Query: 370 KCAENCISTPEYNPV-CGSDNKTYKN 444 +CAE+C P Y+ CGSD TYKN Sbjct: 20 ECAESC---PTYDDERCGSDGVTYKN 42 >SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) Length = 997 Score = 28.3 bits (60), Expect = 5.0 Identities = 24/68 (35%), Positives = 31/68 (45%) Frame = +1 Query: 73 LGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNY 252 LG I SQA NIR Q N +L + N + P+Q GY+ PL +NY Sbjct: 612 LGQITSQAIGSNIR---QDVANVSLPLQMPISNPKTSVPQGGATPMQFGYQGYGPLQHNY 668 Query: 253 NFIAFIFP 276 + IFP Sbjct: 669 GDMNTIFP 676 >SB_33373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 720 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = +1 Query: 385 CISTPE----YNPVCGSDNKTYKNQARL-FCAQNCGVQVTLARQAPCPSSS 522 C+ P+ Y+PV GSD K Y N+ L A ++ LA + P++S Sbjct: 26 CVCPPKCEKVYDPVYGSDGKNYDNECELKRAACTSNRRIILAGRGRVPTTS 76 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +1 Query: 382 NCISTPE----YNPVCGSDNKTYKNQARL-FCAQNCGVQVTLARQAPCPSSSK 525 +C+ P+ Y+PV GSD K Y N+ L A ++ LA + P++++ Sbjct: 589 SCVCPPKCEKVYDPVYGSDGKNYDNECELKRAACTTNKRIILAGRGRVPTTTE 641 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 4/29 (13%) Frame = +1 Query: 382 NCISTPE----YNPVCGSDNKTYKNQARL 456 +C+ P+ Y+PV GSD K Y N+ L Sbjct: 671 SCVCPPKCEKVYDPVYGSDGKNYDNECEL 699 >SB_13131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +1 Query: 370 KCAENCISTPEYNPV-CGSDNKTYKN 444 +CAE+C P Y+ CGSD TYKN Sbjct: 174 ECAESC---PTYDDERCGSDGVTYKN 196 >SB_21821| Best HMM Match : MRG (HMM E-Value=0) Length = 292 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 76 GFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIP 207 G + +A C+ + K E A I NGWNK+ D EW+P Sbjct: 18 GPLIYEAKCIRGQLK---EKTARYLIHYNGWNKNWD----EWVP 54 >SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) Length = 1376 Score = 27.5 bits (58), Expect = 8.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 373 CAENCISTPEYNPVC 417 C +CISTP Y+ +C Sbjct: 1196 CVHSCISTPRYDQIC 1210 >SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) Length = 361 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 385 CISTPEYNPVCGSDNKTYKNQARLFC 462 C+ + ++NPVCG+D+ TY C Sbjct: 137 CVKS-QFNPVCGADDVTYFTPCHAGC 161 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,294,186 Number of Sequences: 59808 Number of extensions: 420262 Number of successful extensions: 1232 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1087 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1231 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -