BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_N07 (330 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1289.10c |||transcription factor |Schizosaccharomyces pombe|... 25 2.2 SPAC607.09c |btn1||battenin CLN3 family protein|Schizosaccharomy... 24 6.8 >SPBC1289.10c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 743 Score = 25.4 bits (53), Expect = 2.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 270 NARARAGSTPAK*YLSH 220 NAR GS PAK Y+SH Sbjct: 151 NARRGQGSEPAKAYMSH 167 >SPAC607.09c |btn1||battenin CLN3 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 396 Score = 23.8 bits (49), Expect = 6.8 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = -2 Query: 110 YIQYNFIKNLPDRFVFLVSY---HRFDHSL*Y 24 ++ +NF+ +L F+F+ Y H F L Y Sbjct: 206 HVSFNFVNSLKQTFIFMQPYLLSHMFPQFLVY 237 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,066,514 Number of Sequences: 5004 Number of extensions: 13928 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 91899990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -