BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_N07 (330 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0456 + 10489544-10491064,10491506-10491632,10491633-10492606 30 0.38 02_01_0427 - 3124209-3124307,3124453-3125240,3125510-3125867,312... 27 3.6 >02_02_0456 + 10489544-10491064,10491506-10491632,10491633-10492606 Length = 873 Score = 30.3 bits (65), Expect = 0.38 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +2 Query: 2 LNLTWGDHIKENGQNGDS-SLKIQNGLEGSL 91 L+ W D +KENGQ + L ++NGL+GS+ Sbjct: 310 LDDVWDDALKENGQCWERLCLPLENGLQGSM 340 >02_01_0427 - 3124209-3124307,3124453-3125240,3125510-3125867, 3125902-3126567 Length = 636 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 119 FSLYIQYNFIKNLPDRFVFLVSYHRFDHSL 30 FS +I NF NLP V +SY++F S+ Sbjct: 179 FSGHIPTNFCTNLPSLAVLELSYNQFSGSI 208 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,364,602 Number of Sequences: 37544 Number of extensions: 74256 Number of successful extensions: 220 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 220 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 447336660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -