BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_N07 (330 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5252| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 >SB_5252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 541 Score = 25.8 bits (54), Expect = 8.5 Identities = 9/31 (29%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = -2 Query: 119 FSLYIQYN-FIKNLPDRFVFLVSYHRFDHSL 30 F+L+ Y+ ++ +L + F+++ +RF+H+L Sbjct: 206 FALFANYSQYVSSLCNPFIYMARCNRFNHAL 236 >SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 25.8 bits (54), Expect = 8.5 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 2 LNLTWGDHIKENGQNGDSSLKIQNGLEGSL 91 ++LTW +KE+G+ +S KI+ +G++ Sbjct: 141 ISLTWSSPVKEDGELMTTSYKIELVAKGTI 170 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,758,553 Number of Sequences: 59808 Number of extensions: 96412 Number of successful extensions: 150 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 463065397 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -