BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_N03 (584 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.52 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 29 2.1 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 2.8 SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) 27 8.5 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 31.5 bits (68), Expect = 0.52 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +1 Query: 376 ALDFYQTALRDPAFYQLYXRIVGYINAFKHYLKPYPQEKLHFVGV*INDVVVEKLVTFFD 555 AL + ALR P ++Y + ++ FK LK YP H + + L+ + D Sbjct: 180 ALRYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEYID 239 Query: 556 YSQ 564 Y Q Sbjct: 240 YGQ 242 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.69 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 317 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 409 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 3/65 (4%) Frame = +1 Query: 31 TGYYPLMT-SYYFPF--AQRPDNYNLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKK 201 T Y P T S Y Q+P+N++LH +A+ T L GKF+S G+ Sbjct: 4715 TSYQPAATDSLYISSQSTQKPNNHHLHRTCKADALEV----NVTLRGGLHAGKFKSVGRT 4770 Query: 202 IDFHD 216 D H+ Sbjct: 4771 RDVHE 4775 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 29.5 bits (63), Expect = 2.1 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 6/91 (6%) Frame = +2 Query: 296 NDLMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKP---HFETLHS-ISYXTGLWVTLTH 457 ++L +L ++ HLN HST T S LT T H +S I++ T +TLTH Sbjct: 25 SNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 458 SSIT*SLILKRNFISSAFKSMMLSLRN*SHS 550 ++T S + S L+ +HS Sbjct: 85 LTLTYSTLTHSTLTHSTLTHSTLTHSTLTHS 115 Score = 29.1 bits (62), Expect = 2.8 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 2/84 (2%) Frame = +2 Query: 302 LMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTLTHSSIT*S 475 L L+L ++ HL +ST T S LT T H +++Y T TLTHS++T S Sbjct: 52 LTHLTLTYSTLTHLTITYSTITHSTLTHLTLT--HL----TLTYSTLTHSTLTHSTLTHS 105 Query: 476 LILKRNFISSAFKSMMLSLRN*SH 547 + S L+ N +H Sbjct: 106 TLTHSTLTHSTITHSTLTHSNLTH 129 Score = 28.7 bits (61), Expect = 3.7 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = +2 Query: 338 HLNHSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTLTHSSIT*SLILKRNFISSAFKS 517 +L HST T S L T T ++++ T + TLTH +IT S I Sbjct: 26 NLTHSTLTHSNLTHLNLTHSTL-TYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 518 MMLSLRN*SHS-LTIANLMPLTV 583 + L+ +HS LT + L T+ Sbjct: 85 LTLTYSTLTHSTLTHSTLTHSTL 107 Score = 27.9 bits (59), Expect = 6.4 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 416 SISYXTGLWVTLTHSSIT*SLILKRNFISSAFKSMMLSLRN*SHS-LTIANLMPLTV 583 ++++ T + +TLTHS++T + N S L+ N +HS LT + L LT+ Sbjct: 1 TLTHPTLIHLTLTHSNLTHLTLTHSNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTL 57 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -2 Query: 223 PFHRGNQFSCHTIRICLSVGTVRKSFQKCPRTVLL-RSSLRCVDC 92 P H NQ C IC+ G KS KCP L S RC C Sbjct: 245 PCHEANQGGCEGRAICVYTGP-GKSICKCPPGYKLDESQARCTLC 288 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +1 Query: 166 LQKGKFE-----SYGKKIDFHDEKAINFVGNYWQENADL--YEEEVTKDYQ 297 L+KGKF+ S K ID E+ F+G+ W ++ DL +++E K+ Q Sbjct: 1093 LEKGKFQVKQWCSNSKTIDKSCERYCTFLGHKWDKDRDLLTFKKEKIKETQ 1143 >SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) Length = 1069 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +1 Query: 181 FESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQRSYEIVAR 321 FE Y ++ DEKA ++ Y ++ A + E +RSY + + Sbjct: 138 FEIYVSLNEWQDEKAGQYLAVYLKDEAKAFYHEQEDSVRRSYRALCK 184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,424,029 Number of Sequences: 59808 Number of extensions: 361740 Number of successful extensions: 1019 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1017 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -