BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_N01 (624 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 23 2.7 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 6.3 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 618 NARWLGKRFEGSISWTRSAITAGPY*STNSLHSAFT 511 N R KR +I+W +A+ P + + H+A T Sbjct: 121 NRRMKDKRQRMAIAWPYAAVYTDPAFAASIFHAAAT 156 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 6.3 Identities = 6/22 (27%), Positives = 13/22 (59%) Frame = -2 Query: 146 FCKWRPVSDRPRGSCISQGNTV 81 F +W+ + ++PR +GN + Sbjct: 444 FARWKDILEKPRQRGTLEGNNM 465 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,816 Number of Sequences: 336 Number of extensions: 2667 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -