BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M24 (350 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 0.29 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 28 1.5 At5g45520.1 68418.m05591 hypothetical protein 27 2.7 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 27 2.7 At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transfera... 27 2.7 At1g14700.1 68414.m01757 purple acid phosphatase, putative conta... 27 3.5 At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) / chlorop... 27 4.6 At4g24150.1 68417.m03465 expressed protein ; expression supporte... 26 6.1 At1g05460.1 68414.m00555 RNA helicase SDE3 (SDE3) identical to R... 26 6.1 At5g59460.1 68418.m07452 scarecrow-like transcription factor 11 ... 26 8.1 At4g15393.1 68417.m02352 cytochrome P450 family protein similar ... 26 8.1 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 26 8.1 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 133 VIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNPLARGG 282 ++A P P+ P+ GP P+S+ PA N+P Y P GG Sbjct: 245 MMAPPPPYGQPPNAGPFTGNSPLSSPPAHSIPPPTNFPGVPYGRPPMPGG 294 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 28.3 bits (60), Expect = 1.5 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 145 PDPFFSQPSNGPSG--NYEPISTGPAFVDFNHPNYPPKRYDNPLAR 276 P P S P N P ++ P + P+ +N P PP YD P R Sbjct: 357 PYPQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPPSMYDGPGGR 402 >At5g45520.1 68418.m05591 hypothetical protein Length = 1167 Score = 27.5 bits (58), Expect = 2.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 319 SFKIANLYETFTSHHGREGCRIAW 248 SFK+ +L E+ T G E +IAW Sbjct: 524 SFKVESLMESLTGLQGLESLKIAW 547 >At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family protein Length = 421 Score = 27.5 bits (58), Expect = 2.7 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 166 PSNGPSGNYEPISTGPAFVDFNHP-NYPPKRYDNP 267 PS+ PS ++ P TGP+ + HP ++ P D P Sbjct: 236 PSSYPSNDHLPPPTGPSDSPYPHPYSHQPYHQDPP 270 Score = 25.8 bits (54), Expect = 8.1 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 142 NPDPFFSQPSNGPSGNYEPISTGP 213 NP+P++S P + P+ + S+ P Sbjct: 316 NPEPYYSSPHSAPAPSSTSFSSAP 339 >At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 456 Score = 27.5 bits (58), Expect = 2.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 5 SDTIRQ*KLSCFSSSPYWPWLP 70 S I + + SC SSP+ PW+P Sbjct: 96 SKIIEEKRYSCIISSPFTPWVP 117 >At1g14700.1 68414.m01757 purple acid phosphatase, putative contains Pfam profile: PF00149 calcineurin-like phosphoesterase; similar to purple acid phosphatase (GI:20257479) [Arabidopsis thaliana] Length = 366 Score = 27.1 bits (57), Expect = 3.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -3 Query: 111 RWNTTIVHHVNSVCGSHGQYGEEEKH 34 +W I HH G HG E EKH Sbjct: 239 KWKIVIGHHTIKSAGHHGNTIELEKH 264 >At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) / chlorophyll b synthase identical to chlorophyll a oxygenase GI:5853117 from [Arabidopsis thaliana]; contains Pfam PF00355 Rieske [2Fe-2S] domain Length = 511 Score = 26.6 bits (56), Expect = 4.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -3 Query: 327 FLLVLKSLIFMRHLLPTTGERVVVSLGWIIGMIEIDERRSSAYGFIIS 184 F +LK+L FM HL E+V V WI + + +Y F IS Sbjct: 462 FAPILKNLPFMEHLWRHFAEQVKVHHKWIDHLQPSSQSCFLSYRFYIS 509 >At4g24150.1 68417.m03465 expressed protein ; expression supported by MPSS Length = 493 Score = 26.2 bits (55), Expect = 6.1 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +1 Query: 73 NRVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 219 N+ + +SG+ + S + DPFFS S+G G AF Sbjct: 102 NQAYTSSHSGMFTPAGSGSAAVTVADPFFSLSSSGEMRRSMNEDAGAAF 150 >At1g05460.1 68414.m00555 RNA helicase SDE3 (SDE3) identical to RNA helicase SDE3 [Arabidopsis thaliana] GI:13811296 Length = 1002 Score = 26.2 bits (55), Expect = 6.1 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +1 Query: 97 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHP 237 SG SD + F ++G SG Y P GP V P Sbjct: 4 SGYKSDDEYSVIADKGEIGFIDYQNDGSSGCYNPFDEGPVVVSVPFP 50 >At5g59460.1 68418.m07452 scarecrow-like transcription factor 11 (SCL11) identical to cDNA scarecrow-like 11 (SCL11) mRNA, partial cds gi:4580526 Length = 172 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = +1 Query: 94 NSGVPSDGNSD--HVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNP 267 N G PS +S+ + P+ +PS G+ + + + N PN P+ +D P Sbjct: 82 NGGNPSSSSSNGGKKSFSEPESSKVEPSGETDGDLKRKQSEVVSEEQNRPNKSPRSFDKP 141 >At4g15393.1 68417.m02352 cytochrome P450 family protein similar to Cytochrome P450 90C1 (ROTUNDIFOLIA3) (SP:Q9M066) [Arabidopsis thaliana]; contains Pfam PF00067: Cytochrome P450 Length = 399 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 184 GNYEPISTGPAFVDFNHPNYPPKRYDNPLA 273 G+Y I G F+ + + ++ P++YD+PLA Sbjct: 363 GDYT-IPAGWIFMGYPYVHFNPEKYDDPLA 391 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 142 NPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 249 +P P S PS+ P + P S P + + P PP Sbjct: 37 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP 72 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 142 NPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 249 +P P S PS+ P + P S P + + P PP Sbjct: 86 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP 121 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,736,673 Number of Sequences: 28952 Number of extensions: 153790 Number of successful extensions: 477 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 469 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 439384704 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -