BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M21 (529 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39720.1 68415.m04874 zinc finger (C3HC4-type RING finger) fa... 30 1.1 At1g65850.1 68414.m07472 disease resistance protein (TIR-NBS-LRR... 29 1.5 At5g35840.1 68418.m04306 phytochrome C (PHYC) identical to SP|P1... 28 3.4 At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger) fa... 28 3.4 At2g18650.1 68415.m02173 zinc finger (C3HC4-type RING finger) fa... 28 3.4 At4g37110.1 68417.m05256 expressed protein 28 4.5 At4g15075.1 68417.m02316 hypothetical protein 28 4.5 At1g13540.1 68414.m01587 expressed protein 28 4.5 At5g56340.1 68418.m07032 zinc finger (C3HC4-type RING finger) fa... 27 5.9 At2g46160.1 68415.m05740 zinc finger (C3HC4-type RING finger) fa... 27 5.9 At5g42870.1 68418.m05225 lipin family protein contains Pfam prof... 23 6.3 At5g44260.1 68418.m05416 zinc finger (CCCH-type) family protein ... 27 7.8 At5g08470.1 68418.m00999 peroxisome biogenesis protein (PEX1) id... 27 7.8 At3g24210.1 68416.m03038 ankyrin repeat family protein contains ... 27 7.8 >At2g39720.1 68415.m04874 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 401 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +3 Query: 102 HHLVAKAKSSATMTARAISEN-LKHVCCLRTWSLLFRSAPICCTNLPASKLT 254 H V K +AR + N + H C+ W + S P+C LPA LT Sbjct: 200 HCAVCKENFVLKSSAREMPCNHIYHPDCILPWLAIRNSCPVCRHELPAEDLT 251 >At1g65850.1 68414.m07472 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1036 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 207 RSAPICCTNLPASKLTHIKWFHSM 278 RS PIC T P+S +H KW H + Sbjct: 13 RSCPICATPFPSSSSSH-KWTHQV 35 >At5g35840.1 68418.m04306 phytochrome C (PHYC) identical to SP|P14714 Phytochrome C {Arabidopsis thaliana} Length = 1111 Score = 28.3 bits (60), Expect = 3.4 Identities = 24/89 (26%), Positives = 38/89 (42%) Frame = -2 Query: 447 VKAVRACGDSNKRLYFCGSSVSSSPPTVKNTRN*GNCLFKFVIAR*LACARSMSKFSLSE 268 V ++R GD+ + ++ SS R G C+ VIAR A + M + L Sbjct: 987 VSSMRLYGDNLRLQQILSETLLSSIRFTPALR--GLCVSFKVIARIEAIGKRMKRVELEF 1044 Query: 267 TILYVSAWMPADLYSRWVQNERAGSKSVG 181 I++ + +P DL Q R G+ G Sbjct: 1045 RIIHPAPGLPEDLVREMFQPLRKGTSREG 1073 >At5g10650.1 68418.m01233 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 525 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 182 PTDLEPALSFCTHLLYKSAG 241 PTD P+LSFC +Y S G Sbjct: 321 PTDPNPSLSFCPSNIYSSTG 340 >At2g18650.1 68415.m02173 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 finger protein RHX1a [Arabidopsis thaliana] GI:3790591; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 423 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 171 HVCCLRTWSLLFRSAPICCTNLPASKLTH 257 HV C+ TW L + P+C +NL + +H Sbjct: 150 HVECIDTWLLSHSTCPLCRSNLLSGFSSH 178 >At4g37110.1 68417.m05256 expressed protein Length = 417 Score = 27.9 bits (59), Expect = 4.5 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 266 PFYMCQLGCRQICTADGCRTKEQAPSP*AAY-VLEIL*YSSCCH 138 P ++C + CR IC CRTK+ AAY + L Y S H Sbjct: 228 PDWICPV-CRDICNCSFCRTKKGWLPTGAAYRKIHKLGYKSVAH 270 >At4g15075.1 68417.m02316 hypothetical protein Length = 168 Score = 27.9 bits (59), Expect = 4.5 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +3 Query: 165 LKHVCCLRTWSLLFRSAP 218 L++ CCL+T ++LF+S P Sbjct: 126 LRNACCLKTATILFKSTP 143 >At1g13540.1 68414.m01587 expressed protein Length = 381 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 347 QLRVFLTVGGDDDTEDPQKYNLLLESPQARTAF 445 +L V +GGDD T DP + +L+ P + + Sbjct: 65 KLAVTFNIGGDDSTRDPVVFIPVLDKPLSSNCY 97 >At5g56340.1 68418.m07032 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 396 Score = 27.5 bits (58), Expect = 5.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 171 HVCCLRTWSLLFRSAPICCTNLPAS 245 HV C+ W L S P+C LP+S Sbjct: 282 HVRCIVPWLELHSSCPVCRFELPSS 306 >At2g46160.1 68415.m05740 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 zinc finger protein ATL6 [Arabidopsis thaliana] GI:4928403; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 214 Score = 27.5 bits (58), Expect = 5.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 171 HVCCLRTWSLLFRSAPIC 224 H+CCL W L S P+C Sbjct: 162 HLCCLDAWLKLNGSCPVC 179 >At5g42870.1 68418.m05225 lipin family protein contains Pfam profile: PF04571 lipin, N-terminal conserved region Length = 930 Score = 23.0 bits (47), Expect(2) = 6.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 203 LSFCTHLLYKSAGIQADTYKMVSLNENLDIDR 298 LS C HLL S G+ A+ +E LD+++ Sbjct: 542 LSLCKHLL--SEGMGAEAASQAFNSEKLDMEK 571 Score = 22.6 bits (46), Expect(2) = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 98 PASPSSQSKVLCYYDSKSYIRESQARMLPTDLE 196 P+ P SQS C+ SK +RE ++ D E Sbjct: 486 PSQPLSQSFDPCFNTSKLDLREDESSSGGLDAE 518 >At5g44260.1 68418.m05416 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 381 Score = 27.1 bits (57), Expect = 7.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 399 CGSSVSSSPPTVKNTRN*GNCLF 331 CG S SSSP +V + +N CLF Sbjct: 177 CGGSPSSSPASVLSNKNNRCCLF 199 >At5g08470.1 68418.m00999 peroxisome biogenesis protein (PEX1) identical to peroxisome biogenesis protein PEX1 [Arabidopsis thaliana] gi|12006272|gb|AAG44817; contains Pfam profile PF00004: ATPase, AAA family; identical to cDNA peroxisome biogenesis protein PEX1 (PEX1) mRNA, partial cds GI:12006271 Length = 1130 Score = 27.1 bits (57), Expect = 7.8 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = +3 Query: 51 SPSPGYWR*RLRLPTTQHHLV-AKAKSSATMTARAISENLKHVCCLRTWSLLFRSAPICC 227 SP+ G W + ++P+ H L+ S T+ ARA ++ + LL + C Sbjct: 578 SPAAGMWFSKFKIPSPGHILIYGPPGSGKTILARAAAKYFE-----EQKDLLAHVILVSC 632 Query: 228 TNLPASKLTHI 260 + L K+ HI Sbjct: 633 STLALEKVQHI 643 >At3g24210.1 68416.m03038 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 607 Score = 27.1 bits (57), Expect = 7.8 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 6/59 (10%) Frame = +2 Query: 344 PQLRVFLTVGGDDDTEDPQKYNLLLESPQAR------TAFTKFCSSSC*AIWF*RDRSN 502 P ++V +T ++ E ++ L SP + A T F +SS + WF R RSN Sbjct: 505 PTIKVLVTFTKFEEIEPVDEFKTPLSSPTSSGYESPAAATTDFTNSSSSSSWFRRSRSN 563 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,850,293 Number of Sequences: 28952 Number of extensions: 208202 Number of successful extensions: 625 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -