BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M20 (589 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 4.4 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 22 4.4 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 22 4.4 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 21 5.8 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 35 KDEPQTVPSAASTPPLSPIDMDS 103 K PQ PS +STP P S Sbjct: 68 KKSPQGAPSPSSTPSSLPTQRTS 90 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/53 (22%), Positives = 25/53 (47%) Frame = +2 Query: 56 PSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKI 214 P AS + S + ++LER+ R++ R + + ++ E ++KI Sbjct: 79 PKGASNGKRARTAYTSSQLVELEREFHRSKYLCRPRRIQMAQNLNLTERQIKI 131 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/53 (22%), Positives = 25/53 (47%) Frame = +2 Query: 56 PSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKI 214 P AS + S + ++LER+ R++ R + + ++ E ++KI Sbjct: 99 PKGASNGKRARTAYTSSQLVELEREFHRSKYLCRPRRIQMAQNLNLTERQIKI 151 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -1 Query: 454 TKIYNYILHSKIKITNRFVCCVLAG 380 TK YN ++H + R C + G Sbjct: 90 TKSYNLLIHERTHTDERPYSCDICG 114 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,824 Number of Sequences: 336 Number of extensions: 2636 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -