BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M20 (589 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 4e-24 SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) 90 1e-18 SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 SB_1224| Best HMM Match : bZIP_1 (HMM E-Value=8e-10) 53 2e-07 SB_41031| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_58135| Best HMM Match : bZIP_1 (HMM E-Value=1.4e-09) 46 2e-05 SB_20196| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_41032| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56664| Best HMM Match : bZIP_1 (HMM E-Value=0.00033) 37 0.014 SB_32179| Best HMM Match : DUF1409 (HMM E-Value=0.071) 36 0.032 SB_11068| Best HMM Match : bZIP_1 (HMM E-Value=9.2) 36 0.032 SB_282| Best HMM Match : zf-CCCH (HMM E-Value=2.4e-10) 35 0.043 SB_55988| Best HMM Match : bZIP_1 (HMM E-Value=7.4e-06) 35 0.043 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 35 0.057 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 35 0.057 SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.099 SB_43304| Best HMM Match : bZIP_Maf (HMM E-Value=1e-05) 34 0.099 SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_37872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_9266| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_40358| Best HMM Match : Pox_A32 (HMM E-Value=0.058) 33 0.23 SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) 32 0.30 SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43) 32 0.40 SB_11657| Best HMM Match : bZIP_2 (HMM E-Value=3e-16) 31 0.53 SB_56783| Best HMM Match : YicC_N (HMM E-Value=8.6e-07) 31 0.70 SB_44702| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.03) 31 0.92 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 31 0.92 SB_58660| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_2929| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 30 1.6 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 29 2.1 SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) 29 2.1 SB_16005| Best HMM Match : bZIP_Maf (HMM E-Value=5.6e-32) 29 2.8 SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_26345| Best HMM Match : DUF1531 (HMM E-Value=2.4) 29 2.8 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 29 3.7 SB_42963| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_48008| Best HMM Match : M (HMM E-Value=0.0068) 29 3.7 SB_22570| Best HMM Match : Filament (HMM E-Value=0.1) 29 3.7 SB_11299| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 28 4.9 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 28 4.9 SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) 28 4.9 SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) 28 4.9 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_50330| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-17) 28 6.5 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 28 6.5 SB_31791| Best HMM Match : PIG-U (HMM E-Value=0.15) 28 6.5 SB_55733| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00036) 27 8.6 SB_54664| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_43331| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 27 8.6 SB_3565| Best HMM Match : ASC (HMM E-Value=1.1e-12) 27 8.6 SB_54574| Best HMM Match : WD40 (HMM E-Value=0) 27 8.6 SB_42708| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_24885| Best HMM Match : HOOK (HMM E-Value=0.00023) 27 8.6 SB_16704| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 108 bits (259), Expect = 4e-24 Identities = 52/103 (50%), Positives = 73/103 (70%) Frame = +2 Query: 14 RYPTPMVKDEPQTVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISK 193 R+ ++++ Q VP TPPL PID+D QE +K ERK+ RNR+AASKCR+RKLE+ ++ Sbjct: 103 RFGEIKMEEQSQVVPH---TPPLPPIDLDLQEAVKNERKKLRNRLAASKCRKRKLEKEAE 159 Query: 194 LEDKVKILKGENAELAQMVVKLKDHVHRLKEQVLEHANGGCHI 322 LEDKVK+LK +N +L +L+ V LKEQV+ H +GGC + Sbjct: 160 LEDKVKVLKDKNTKLVSEAQELRRLVCELKEQVMNHVSGGCQV 202 >SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) Length = 382 Score = 89.8 bits (213), Expect = 1e-18 Identities = 48/99 (48%), Positives = 65/99 (65%), Gaps = 3/99 (3%) Frame = +2 Query: 35 KDEPQTVP---SAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDK 205 K E Q P S PL PID++ QE +K ERK+Q+NRVAASKCRR+KLER ++LE + Sbjct: 276 KYEEQAAPPHNSGLGGLPLPPIDLELQEIVKRERKKQKNRVAASKCRRKKLEREAQLEVR 335 Query: 206 VKILKGENAELAQMVVKLKDHVHRLKEQVLEHANGGCHI 322 V+ LK ++ EL + L+ V LK++VLEH GC + Sbjct: 336 VQQLKEKSIELNAVASALRQQVGELKQRVLEHVAFGCQL 374 >SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 85.4 bits (202), Expect = 3e-17 Identities = 45/91 (49%), Positives = 62/91 (68%) Frame = +2 Query: 35 KDEPQTVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKI 214 K E QT S L PID++ QE +K ERK+QRNR+A+SKCR+RKLER ++LE++VK Sbjct: 452 KLESQTTESGV----LQPIDLEIQEVVKRERKKQRNRIASSKCRKRKLEREARLENRVKD 507 Query: 215 LKGENAELAQMVVKLKDHVHRLKEQVLEHAN 307 LK N EL + LK V LK++V++H + Sbjct: 508 LKERNIELNAVANALKQQVCDLKQRVMDHVD 538 >SB_1224| Best HMM Match : bZIP_1 (HMM E-Value=8e-10) Length = 496 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/66 (34%), Positives = 44/66 (66%) Frame = +2 Query: 107 ERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKE 286 E +K+ R+RQRN+ AAS+CR ++ +R+ +L+ + L+ +NAE+ + + L+ + L+ Sbjct: 286 EELKIIRRRQRNKQAASRCREKRRQRLEELQREATELEEQNAEVERDIATLRVEYNELEA 345 Query: 287 QVLEHA 304 + EHA Sbjct: 346 LLTEHA 351 >SB_41031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 48.4 bits (110), Expect = 4e-06 Identities = 27/81 (33%), Positives = 48/81 (59%) Frame = +2 Query: 62 AASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELA 241 A ST ++P + +ER KL +R+RN+VAASKCR+++ + + L + L+ +N L Sbjct: 87 AESTEMVTP---EEEERRKL--RRERNKVAASKCRQKRKQHVRNLVQVSEALEVQNNTLQ 141 Query: 242 QMVVKLKDHVHRLKEQVLEHA 304 + KL D + +L+ + H+ Sbjct: 142 SQITKLHDEIKQLEFMLDSHS 162 >SB_58135| Best HMM Match : bZIP_1 (HMM E-Value=1.4e-09) Length = 275 Score = 46.4 bits (105), Expect = 2e-05 Identities = 26/86 (30%), Positives = 49/86 (56%), Gaps = 6/86 (6%) Frame = +2 Query: 92 DMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHV 271 ++ E K +R+RN++AA KCR+R+ E I +LE + + ++ N EL + + +L + Sbjct: 167 ELSPAELEKRRIRRERNKLAAFKCRQRRKEHIQELEIESEGIEDSNKELEREISELHEQR 226 Query: 272 HRLKEQVLEHA------NGGCHIESH 331 +L+E + H+ NGG +S+ Sbjct: 227 QQLEEMLKTHSCKLSNNNGGSRTKSN 252 >SB_20196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 44.8 bits (101), Expect = 5e-05 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Frame = +2 Query: 74 PPLSPIDMDSQERI--KLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQM 247 P ++P + E K E + +NR AA +CRR+K E + LE++V +L+ +N L + Sbjct: 225 PGIAPSNQQIAEEATRKREMRLMKNREAAKECRRKKKEYVKCLENRVAVLENQNKTLIEE 284 Query: 248 VVKLKD 265 + LKD Sbjct: 285 LKALKD 290 >SB_41032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 40.7 bits (91), Expect = 9e-04 Identities = 23/78 (29%), Positives = 41/78 (52%) Frame = +2 Query: 68 STPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQM 247 S+P + + + R K+ +RQRN+VAASKCR ++ E + L + L+ N++L Sbjct: 72 SSPQYEELTPEEETRRKV--RRQRNKVAASKCRLKRREHVKNLLKASEELESANSKLESD 129 Query: 248 VVKLKDHVHRLKEQVLEH 301 + L +L+ + H Sbjct: 130 IACLNAEKEQLERMLDAH 147 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 38.7 bits (86), Expect = 0.003 Identities = 24/86 (27%), Positives = 43/86 (50%) Frame = +2 Query: 41 EPQTVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILK 220 E +T P + + + + +RKR +N+ AA++ R +K + S+L D+ + L+ Sbjct: 422 EIKTTPYSRKNTKSDTVSPKLKTPAQRQRKRVQNKDAATRYRVKKKDEQSRLFDEAEKLE 481 Query: 221 GENAELAQMVVKLKDHVHRLKEQVLE 298 EN +L V L + LK +LE Sbjct: 482 KENNKLKDEVGSLSKEIEYLKNLMLE 507 >SB_56664| Best HMM Match : bZIP_1 (HMM E-Value=0.00033) Length = 652 Score = 36.7 bits (81), Expect = 0.014 Identities = 21/87 (24%), Positives = 45/87 (51%) Frame = +2 Query: 2 ADLDRYPTPMVKDEPQTVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLE 181 AD D + +++ + A T L + + ++ R+R +N+ AA CR+RK++ Sbjct: 382 ADADSLDIGVSEEKIVEMSVAEFTTFLEKLSDAQAKYVRDVRRRGKNKEAARICRKRKMD 441 Query: 182 RISKLEDKVKILKGENAELAQMVVKLK 262 I L+D++ LK + + ++ ++K Sbjct: 442 AIETLDDEITRLKQQRQSMFELDGEVK 468 >SB_32179| Best HMM Match : DUF1409 (HMM E-Value=0.071) Length = 429 Score = 35.5 bits (78), Expect = 0.032 Identities = 24/85 (28%), Positives = 46/85 (54%) Frame = +2 Query: 50 TVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGEN 229 T+ ST P SP ++ S + +++ + + + + I +LEDK++ LK EN Sbjct: 262 TLEKGTSTDPRSPSELKSPDNSQVKTGDSKQGLLS--------QSIEQLEDKIRELKQEN 313 Query: 230 AELAQMVVKLKDHVHRLKEQVLEHA 304 ++L Q++ K ++ + R+ E LE A Sbjct: 314 SDLRQLLDKAEEKI-RIYEIDLEKA 337 >SB_11068| Best HMM Match : bZIP_1 (HMM E-Value=9.2) Length = 106 Score = 35.5 bits (78), Expect = 0.032 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +2 Query: 68 STPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKL 196 S+P + + + R K+ +RQRN+VAASKCR ++ E + L Sbjct: 64 SSPQYEELTPEEETRRKV--RRQRNKVAASKCRLKRREHVKNL 104 >SB_282| Best HMM Match : zf-CCCH (HMM E-Value=2.4e-10) Length = 508 Score = 35.1 bits (77), Expect = 0.043 Identities = 21/62 (33%), Positives = 32/62 (51%) Frame = +2 Query: 20 PTPMVKDEPQTVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLE 199 P + DEP V SA + PL+PI+ ++++ ++ N KCR E ISK + Sbjct: 11 PRHKMADEPAQVASAENKLPLTPIENARRQKVCRFYAKKGNCRFGEKCRFVHKEIISKED 70 Query: 200 DK 205 DK Sbjct: 71 DK 72 >SB_55988| Best HMM Match : bZIP_1 (HMM E-Value=7.4e-06) Length = 150 Score = 35.1 bits (77), Expect = 0.043 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 6/75 (8%) Frame = +2 Query: 38 DEPQTVPSAASTPPLSPIDMDSQER------IKLERKRQRNRVAASKCRRRKLERISKLE 199 D ++ S S SP ++ ++R I LE K +R+R +A +CR RK R LE Sbjct: 43 DSNSSIKSPHSPKITSPRKLEGKKRGRKPSQIDLEAKLERSRQSARECRARKKLRYKCLE 102 Query: 200 DKVKILKGENAELAQ 244 D V + E ++L Q Sbjct: 103 DTVTRKESEVSKLRQ 117 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 34.7 bits (76), Expect = 0.057 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Frame = +2 Query: 104 QERI-KLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRL 280 ++RI LE++ R+++ S+ L +L+++ K LK E+ ELA+ KLKD + L Sbjct: 1918 EQRIASLEKEASRSQMTGSE--GEVLTENDRLKEENKTLKEEHTELAEQNEKLKDALEEL 1975 Query: 281 KEQV 292 +E V Sbjct: 1976 REAV 1979 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 34.7 bits (76), Expect = 0.057 Identities = 22/84 (26%), Positives = 43/84 (51%) Frame = +2 Query: 104 QERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLK 283 Q ++L +QR S R K ER KL ++ ++K NA+ M ++++ RL+ Sbjct: 764 QLHVELTNIKQRLAETESASSRLKGER-EKLHKELTVMKENNAQWKDMCERIQEDKERLQ 822 Query: 284 EQVLEHANGGCHIESHF*SRCRRL 355 +++++ +ES F S +R+ Sbjct: 823 KEMIDLQKSMSKVESSFGSSQQRV 846 >SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 33.9 bits (74), Expect = 0.099 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 2/93 (2%) Frame = +1 Query: 4 RPRSVPDTYGERRASNSAQRSQHAAALPY*HGL-SRENQTRTQT-TKESSRSVQMSTSQT 177 R R P T +N + R+ HA G +R +T T++ T+ SRS S +T Sbjct: 216 RTRPSPSTASSANETNESGRTTHARTAASARGRGNRRGRTGTRSSTRGRSRSTATSRGRT 275 Query: 178 RTYL*TRGQSEDFKRGECGARTDGGEVERPRSQ 276 RT TR +S R +R+ G + +++ Sbjct: 276 RTRTSTRRRSHTSSREGTRSRSTRGRKTKSKNR 308 >SB_43304| Best HMM Match : bZIP_Maf (HMM E-Value=1e-05) Length = 96 Score = 33.9 bits (74), Expect = 0.099 Identities = 20/72 (27%), Positives = 41/72 (56%), Gaps = 4/72 (5%) Frame = +2 Query: 95 MDSQERIKLERKRQ--RNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDH 268 +++ E ++L ++R+ +NR+ AS C+++++ E + +IL E L + K+K Sbjct: 4 LENSEIVRLRKRRRSLKNRIYASVCKKKRVAEQKTYEVQNRILVKERNTLKMELEKVKTE 63 Query: 269 VHRLKE--QVLE 298 ++KE Q LE Sbjct: 64 RDKIKEAYQTLE 75 >SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 33.1 bits (72), Expect = 0.17 Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = +2 Query: 74 PPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAEL 238 P S ++D ER + + +RNR AA++CR ++ + +LE K L N +L Sbjct: 365 PRRSQEELDPDERRR--KFLERNRAAATRCREKRKIWVQQLEKKADDLSNTNTQL 417 >SB_37872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 33.1 bits (72), Expect = 0.17 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 107 ERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKI-LKGENAELAQMVVKLKDHVHRLK 283 ER++ E+K A ++ + L I +V I L+G+ E ++ VKL++ V+RLK Sbjct: 176 ERLESEQKEHAQAEAKTQKSEQFLRNIEAKSKQVIIALRGQLDEASEEKVKLEEEVNRLK 235 Query: 284 EQV 292 QV Sbjct: 236 NQV 238 >SB_9266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1490 Score = 33.1 bits (72), Expect = 0.17 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +2 Query: 176 LERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKE 286 L R+S LE++ +LK +NA L V+ L+ +H++ + Sbjct: 133 LRRVSSLEEENTVLKSKNAALTLEVLSLRAQIHKINQ 169 >SB_40358| Best HMM Match : Pox_A32 (HMM E-Value=0.058) Length = 874 Score = 32.7 bits (71), Expect = 0.23 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = +1 Query: 19 PDTYGERRASNSAQRSQHAAALPY*HGLSRENQTRTQTTKESSRSVQMSTSQTRT 183 PD + R+ +SA RS+ +AA+ HG+SR TR +T + S + T+T Sbjct: 761 PDGHQGARSGDSASRSRVSAAI---HGVSRHLDTRVHSTHIRTMSTTQQSKITKT 812 >SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) Length = 362 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 317 GSRRSRAPTPAPSACERGLSTSPPSVRAPHSPLLKSSLCP 198 G+ S P P C+R + T PSV P S +SSL P Sbjct: 67 GAESSSMPDPVRKTCQRRVKTFHPSVDTPMSTFGRSSLGP 106 >SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43) Length = 443 Score = 31.9 bits (69), Expect = 0.40 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 1/70 (1%) Frame = +2 Query: 14 RYPTPMVKDEPQTVPSAASTPPLSPIDMDSQ-ERIKLERKRQRNRVAASKCRRRKLERIS 190 R + M+ TVP+ TPPL P+ +DS+ +R+ R R+ + + R+RKL+R+ Sbjct: 282 RERSKMLSRGSSTVPT---TPPL-PVVLDSKLQRLNKRIAGVRQRLESLRGRKRKLQRMR 337 Query: 191 KLEDKVKILK 220 + ++ V+ K Sbjct: 338 EEQETVRHFK 347 >SB_11657| Best HMM Match : bZIP_2 (HMM E-Value=3e-16) Length = 298 Score = 31.5 bits (68), Expect = 0.53 Identities = 21/77 (27%), Positives = 37/77 (48%) Frame = +2 Query: 35 KDEPQTVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKI 214 KDE + P D ++ + +R +N VAA + R + ++ ++ K K Sbjct: 143 KDEYEYNPLPIGKKARRKFVPDQEKDDRYWARRVKNNVAARRSRDMRRQKEIEISMKWKQ 202 Query: 215 LKGENAELAQMVVKLKD 265 L+ ENA L + + +LKD Sbjct: 203 LEKENARLREELQQLKD 219 >SB_56783| Best HMM Match : YicC_N (HMM E-Value=8.6e-07) Length = 251 Score = 31.1 bits (67), Expect = 0.70 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +2 Query: 218 KGENAELAQMVVKLKDHVHRLKEQVL 295 K +AE+ ++VV +KD + ++KEQVL Sbjct: 223 KSNHAEMQKLVVMMKDELEKIKEQVL 248 >SB_44702| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.03) Length = 307 Score = 30.7 bits (66), Expect = 0.92 Identities = 15/61 (24%), Positives = 36/61 (59%), Gaps = 3/61 (4%) Frame = +2 Query: 116 KLERKRQRNRVAASKCR---RRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKE 286 +LE + ++ +V+ + R L R++++E++ +L+ E+ + ++ KLK + +KE Sbjct: 86 ELEEESRKYKVSLQRSRVGDAIDLRRLAEVEEENTVLQAESRKQISLISKLKSDIKSIKE 145 Query: 287 Q 289 Q Sbjct: 146 Q 146 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 30.7 bits (66), Expect = 0.92 Identities = 18/69 (26%), Positives = 36/69 (52%) Frame = +2 Query: 92 DMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHV 271 ++D + R E + +R+R + +RR+ E K ED+VK + + + +KL + Sbjct: 623 EIDDEMRKLEEERTERDRQKEEERKRREEEEKKKREDEVKREEEGRRQKVEAELKLIEDE 682 Query: 272 HRLKEQVLE 298 H+ + + LE Sbjct: 683 HKQRLEELE 691 >SB_58660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 960 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/48 (33%), Positives = 28/48 (58%) Frame = +2 Query: 122 ERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKD 265 ERKR++ A +C R ++E +L K ++L+ N +L + V L+D Sbjct: 648 ERKRRQEAELARQCHRNEIE---QLTFKTRLLEQSNTDLLRAVRSLED 692 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 4/87 (4%) Frame = +2 Query: 35 KDEPQTVPSAASTPPL---SPIDMDSQERIKLERKRQRNRVAASKCRR-RKLERISKLED 202 +DE + +PS A+ PPL P +Q + E ++R + K +R R+L+R + ++ Sbjct: 948 EDEYEILPSEAAAPPLPDTRPGASPTQSEVDAEESKKREKKDKEKEKRERELQRKKERDE 1007 Query: 203 KVKILKGENAELAQMVVKLKDHVHRLK 283 + + + E E + K ++ R K Sbjct: 1008 QKRKKEEEKREREEKKRKEEERKRREK 1034 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 92 DMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKG 223 + D Q+R K E KR+R + R++ E+ K K+ LKG Sbjct: 1004 ERDEQKRKKEEEKREREEKKRKEEERKRREKADKELKKIHKLKG 1047 >SB_2929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 83 SPIDMDSQERIKLERKRQRNRVAASKCRRRKLE-RISKLEDKVKILKGENAELAQMV 250 SPI+ D +E +KL +K ++ +V + E KL + IL G++ L+ +V Sbjct: 99 SPIESDEKEIVKLAKKLKKEKVNVDVVNFGEEESNTEKLTAFINILNGKDGNLSHLV 155 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 299 APTPAPSACERGLSTSPPSVRAPHSP 222 APTP P + T PP RAP +P Sbjct: 95 APTPTPMVAQSVAPTPPPPPRAPETP 120 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/66 (24%), Positives = 38/66 (57%), Gaps = 3/66 (4%) Frame = +2 Query: 98 DSQERIKLERKRQRNRVAASKCR---RRKLERISKLEDKVKILKGENAELAQMVVKLKDH 268 + QER++ +R+++ R+A + R +RK+E + L++ +K + + AE + K + Sbjct: 225 EEQERLEQQRRQREQRIAEKRKRLEEQRKVESLHLLKELLKRVADKRAEEEEEKRKREKE 284 Query: 269 VHRLKE 286 + L++ Sbjct: 285 LEMLRQ 290 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 29.5 bits (63), Expect = 2.1 Identities = 28/108 (25%), Positives = 53/108 (49%), Gaps = 1/108 (0%) Frame = +2 Query: 32 VKDEPQTVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVK 211 ++ + + + +++ S D++ ++++KLE R+RN +A ++KL I K+E K Sbjct: 1084 LEKQAKALNDGSNSTKTSSQDLE-KKKMKLEEDRKRNEIA-----KQKLASIRKIE---K 1134 Query: 212 ILKGENAELAQMVVKLKDHVHRLKEQVLEHANGGCH-IESHF*SRCRR 352 IL + + K+HV L++ LE H E+ R RR Sbjct: 1135 ILTFIETARWSAIKRAKEHVKSLQKGGLEIKKRDLHESENEIEKRRRR 1182 >SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) Length = 804 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +1 Query: 40 RASNSAQRSQHAAALPY*HGLSRENQTRTQTTKESSRSVQMSTSQTRT 183 R+ +SA RS+ +AA+ HG+SR TR +T + S + T+T Sbjct: 698 RSGDSASRSRVSAAI---HGVSRHLDTRVHSTHIRTMSTTQQSKITKT 742 >SB_16005| Best HMM Match : bZIP_Maf (HMM E-Value=5.6e-32) Length = 160 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 89 IDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLED 202 + + Q RIK R+ +NR A CR +++ + LE+ Sbjct: 79 LSTEEQSRIKYRRRTLKNRGYAHNCRIKRISQKKSLEE 116 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.1 bits (62), Expect = 2.8 Identities = 21/48 (43%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -3 Query: 359 RRGDGIAIRSAIRCGSR-RSRAPTPAPS-ACERGLSTSPPSVRAPHSP 222 RR + RS R GSR R R+P+ +P ER S SP R HSP Sbjct: 130 RRSPSLERRSRSRSGSRERRRSPSRSPERRRERSFSNSPK--RERHSP 175 >SB_26345| Best HMM Match : DUF1531 (HMM E-Value=2.4) Length = 169 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = +2 Query: 35 KDEPQTVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAAS---KCRRRKLERISKLEDK 205 K E +TVP T S +E+ + E ++ A S K ++RK+E + +E+K Sbjct: 68 KTEEETVPETVQTETPSARKKKKKEKEQEETMEEQQTEATSSAKKKKKRKVEDVEDVEEK 127 Query: 206 VK 211 V+ Sbjct: 128 VE 129 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 28.7 bits (61), Expect = 3.7 Identities = 22/94 (23%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +1 Query: 1 RRPRSVPDTYGER-RASNSAQRSQHAAALPY*HGLSRENQTRTQTTKESSRSVQMSTSQT 177 R PR + ER R S RS+H + + R++ + + ++ SRS + S++ Sbjct: 244 RSPRRNSQRHKERSRYHRSRSRSRHRRSRSNSPSM-RKSDRKFKKSQRKSRSRSRNRSRS 302 Query: 178 RTYL*TRGQSEDFKRGECGARTDGGEVERPRSQA 279 + +R S R + G+R++ ++ RS++ Sbjct: 303 HSRKRSRSSSRSKSRKKSGSRSNSQSKQKSRSRS 336 >SB_42963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 305 SRAPTPAPSACERGLSTSPPSVR 237 SRAPT +PS C + PPS R Sbjct: 310 SRAPTRSPSGCSSDSTNPPPSPR 332 >SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1005 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 32 VKDEPQTVPSAASTPPLSPIDMDSQERIKLER 127 VK + ++ +TPP SP +D RIK+ER Sbjct: 821 VKQDIRSRSRGENTPPKSPTRLDLSPRIKIER 852 >SB_48008| Best HMM Match : M (HMM E-Value=0.0068) Length = 1068 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 185 ISKLEDKVKILKGENAELAQMVVKLKDHVHRLKEQVLE 298 + LE VKIL+ +EL + + LK+ H L++ + E Sbjct: 563 VDSLEADVKILREHESELKKEMTSLKERNHNLEQMLNE 600 >SB_22570| Best HMM Match : Filament (HMM E-Value=0.1) Length = 601 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 119 LERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKD 265 L + +R +CRRR E ++ L+ K+K L+ + Q++ K+ Sbjct: 223 LNERLERKESTLMECRRRHDEELTSLQKKIKNLEERLSSTNQLISSTKN 271 >SB_11299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3762 Score = 28.7 bits (61), Expect = 3.7 Identities = 25/91 (27%), Positives = 41/91 (45%) Frame = +2 Query: 5 DLDRYPTPMVKDEPQTVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLER 184 D P V+ EP S PP P + +S+E + E++ + + + E Sbjct: 3097 DAPNSPEKAVQSEPWYWTWLFSRPPQQPEEKESEEANEHEQEHEHD----TSGDHIHFEP 3152 Query: 185 ISKLEDKVKILKGENAELAQMVVKLKDHVHR 277 I L DKV+ + GE A+ Q V K + ++R Sbjct: 3153 IIPLPDKVERVTGEEAD--QEVFKWRAKLYR 3181 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/65 (24%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Frame = +2 Query: 104 QERIKLERKRQRNRVAASKCRRRK---LERISKLEDKVKILKGENAELAQMVVKLKDHVH 274 Q++++ E+K + ++ K +R K ER+ + E+K K + E A+ + + +D +H Sbjct: 928 QQQLEKEKKEKEKKLLIEKEKREKEKQKERLREKEEKEKQKEAERAKKEKERLLQEDKLH 987 Query: 275 RLKEQ 289 +E+ Sbjct: 988 EKEEK 992 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 28.3 bits (60), Expect = 4.9 Identities = 19/64 (29%), Positives = 34/64 (53%) Frame = +2 Query: 98 DSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHR 277 + Q+ +K ER R+ A +R LE KLE++ K + + ELA++ K ++ R Sbjct: 191 ERQKALKEERMRKLQE-EARLAAQRALEEKRKLEEERKEQERKEKELAELEKKRQEERRR 249 Query: 278 LKEQ 289 +E+ Sbjct: 250 QEEK 253 >SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) Length = 374 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +2 Query: 101 SQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRL 280 +QE ++ ER+ + NR+ + R ++ E K ++ + GE+ E +KLK+ + Sbjct: 192 AQEEMRREREEEENRILEEEERVKREEEEKKAKEVEEKRMGEDEE----QIKLKEEEVEI 247 Query: 281 KE 286 KE Sbjct: 248 KE 249 >SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) Length = 2565 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 104 QERIKLERKRQRNRVAASKCRRRKLERISKLEDK 205 Q R K RKR+R R + + RRR+ R S+L K Sbjct: 684 QRRRKRRRKRRRQRRSRRRRRRRRRRRRSQLRRK 717 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 28.3 bits (60), Expect = 4.9 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +2 Query: 125 RKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKEQVLE 298 +K+++ V + + K RIS LE +V +L NAEL + K H K + +E Sbjct: 272 KKKEKQEVESDL--KYKTARISTLEKEVAVLHQANAELKNKADRFK-HTEEEKNKAIE 326 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +2 Query: 107 ERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKI-LKGENAELAQMVVKLKDHV 271 E +KLER++ + + K + K+ER + + I + EN++L++ V L+ V Sbjct: 972 EEVKLERRKHQEELETLKDKTLKVERELRDSQQENIKMNIENSKLSRKVSSLESSV 1027 >SB_50330| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-17) Length = 452 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/59 (28%), Positives = 24/59 (40%) Frame = +2 Query: 131 RQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKEQVLEHAN 307 +Q N+ + R ER +K D K + + + L DH L QV EH N Sbjct: 311 KQTNKRTNEQTNERTNERTNKQRDNKNEKKINKTTTSVIYLSLCDHERHLLVQVQEHRN 369 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/40 (32%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = +2 Query: 197 EDKVKILKGENAELAQMVVKLKDHVHRLKEQ---VLEHAN 307 E+K++ LK N+EL + +L+D +L+++ +L+ AN Sbjct: 334 EEKIRKLKKRNSELVSIARQLEDKAKKLQDEKNAILKQAN 373 >SB_31791| Best HMM Match : PIG-U (HMM E-Value=0.15) Length = 1366 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 373 SLECGGEATASRSE-VRFDVAAAVRVLQHLLLQPVNVVFQ 257 S+ G A SE ++ +V RVL +L+LQ NV+FQ Sbjct: 118 SITLSGVVFADNSECLKVEVVGIPRVLSNLMLQLKNVLFQ 157 >SB_55733| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00036) Length = 1211 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/71 (25%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = +2 Query: 89 IDMDSQERIKLERKRQRNRVAASKCRRRKLE-RISKLEDKVKILKGENAELAQMVVKLKD 265 ID S E+++ + + ++ + A + L ++ LEDK+ +N+EL V K + Sbjct: 31 IDGRSNEQLEAKVMQLQSTLVAHESTIESLRGEVTVLEDKLHNETSKNSELEGKVEKQRQ 90 Query: 266 HVHRLKEQVLE 298 + R+K + E Sbjct: 91 DIKRIKREKSE 101 >SB_54664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 170 RKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLK 283 R+LER+ + E K++ ++ E + VKLKD + LK Sbjct: 42 RELERLRESEQKIRQVQEEIPKCITESVKLKDLLEELK 79 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +2 Query: 179 ERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKEQV 292 E+ ++L+ K L ENAELA+ L+ + RLK+++ Sbjct: 287 EQFARLQAKYDELVAENAELAENCDLLEKNEARLKKEI 324 >SB_43331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 27.5 bits (58), Expect = 8.6 Identities = 22/86 (25%), Positives = 38/86 (44%) Frame = +2 Query: 65 ASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQ 244 AST L P +R ++ RN V + +RK +R + E+K K L + + + Sbjct: 67 ASTIDLLPRKKFLNDREYMKELFYRNDVVVTGPEKRKYKRTTHWEEKSKKLIRDTKKCLK 126 Query: 245 MVVKLKDHVHRLKEQVLEHANGGCHI 322 ++ L + H + +GG HI Sbjct: 127 VMPLLSNGEH--PNSIFTSVDGGNHI 150 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +2 Query: 128 KRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKEQV 292 K ++ K R E++ +L KV L+GE E + KLK + +EQ+ Sbjct: 1322 KALEKEISNLKDRNNNGEKVQELLHKVTYLEGELKERSVETEKLKQTLQEREEQI 1376 >SB_3565| Best HMM Match : ASC (HMM E-Value=1.1e-12) Length = 575 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 20 PTPMVKDEPQTVPSAASTPPLSPIDMDSQER-IKLERKRQR 139 PT + EP T P+ L P D + ER + +E K+++ Sbjct: 36 PTTVPTTEPTTAPTTPEPTTLEPTDPPTTERPLTMEEKKEQ 76 >SB_54574| Best HMM Match : WD40 (HMM E-Value=0) Length = 1050 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 291 TCSFSL*TWSFNFTTICASSAFSP 220 +CS TW +N ++ C S AFSP Sbjct: 705 SCSSGEQTWVYNSSSTCLSLAFSP 728 >SB_42708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = +2 Query: 101 SQERIKLERK--RQRNRVAASKCRRRKLERISKLEDKVKILKGENAEL 238 S R + E K + R +VAA + R R ER+S++++ L+ EN EL Sbjct: 107 SSRRTQNESKSCKARQKVAAQEARERNEERLSEIDE----LERENREL 150 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/64 (26%), Positives = 36/64 (56%) Frame = +2 Query: 98 DSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHR 277 + +ER + +R+R+ R+A K RR ER+ + E++ ++ E + + ++ V R Sbjct: 1040 EERERREADRRREEERIAEQK-RRDDEERLRREEEERRL----EEERRREEERKREEVRR 1094 Query: 278 LKEQ 289 L+E+ Sbjct: 1095 LEEE 1098 >SB_24885| Best HMM Match : HOOK (HMM E-Value=0.00023) Length = 873 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/53 (26%), Positives = 28/53 (52%) Frame = +2 Query: 23 TPMVKDEPQTVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLE 181 +P ++ +PS AS+P I S ER E K+++++ +C ++ L+ Sbjct: 607 SPAPSNDTSPIPSGASSPAAQRIPA-SAEREFRELKKEKSKFFKHECHQKNLK 658 >SB_16704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 988 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +2 Query: 47 QTVPSAASTPPLSPIDMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKI 214 Q + S ST D+D ++ ++ K +RN KCR L+R K + K+ Sbjct: 668 QLIKSCQSTIQHLCSDVDPKDLLRCLEKHKRNPQMTKKCREIVLKRQKKQYEDYKL 723 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,366,453 Number of Sequences: 59808 Number of extensions: 371406 Number of successful extensions: 1828 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 1574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1805 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -