BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M18 (610 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49735| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 30 1.3 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 30 1.3 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 30 1.3 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 30 1.3 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 30 1.3 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 30 1.3 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 30 1.3 SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 30 1.3 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_14547| Best HMM Match : UCR_TM (HMM E-Value=2.7) 30 1.3 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 30 1.3 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 30 1.7 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 30 1.7 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.7 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 30 1.7 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.7 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.7 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.7 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 30 1.7 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 30 1.7 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.7 SB_41282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_40017| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_9511| Best HMM Match : DUF11 (HMM E-Value=0.097) 28 5.1 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_24692| Best HMM Match : Disintegrin (HMM E-Value=7.6e-23) 28 6.8 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_44981| Best HMM Match : AA_permease (HMM E-Value=9.6e-13) 27 9.0 SB_11966| Best HMM Match : adh_short (HMM E-Value=4.1e-32) 27 9.0 SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) 27 9.0 >SB_49735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 30.7 bits (66), Expect = 0.97 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 113 CANPQIRQRQHWRGRIPIW 169 CA QI Q++HWR R IW Sbjct: 17 CARSQIAQKRHWRPRRQIW 35 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 10 LEVDGIDKLDIEF 22 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 28 LEVDGIDKLDIEF 40 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 53 LEVDGIDKLDIEF 65 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 25 LEVDGIDKLDIEF 37 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 10 LEVDGIDKLDIEF 22 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) Length = 163 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 24 LEVDGIDKLDIEF 36 >SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) Length = 158 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 25 LEVDGIDKLDIEF 37 >SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 28 LEVDGIDKLDIEF 40 >SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 12 LEVDGIDKLDIEF 24 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 569 SAPRAEFDIKLIDTVDLE 516 S + EFDIKLIDTVDLE Sbjct: 17 SPGQQEFDIKLIDTVDLE 34 >SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 24 LEVDGIDKLDIEF 36 >SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_14547| Best HMM Match : UCR_TM (HMM E-Value=2.7) Length = 137 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 516 LEVDGIDKLDIEFGTRRRHVV*KSIPLQPLD 608 LEVDGIDKLD+ T + H L PL+ Sbjct: 23 LEVDGIDKLDVTLKTAKGHTNRPISKLYPLE 53 >SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 61 LEVDGIDKLDIEF 73 >SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.9 bits (64), Expect = 1.7 Identities = 20/72 (27%), Positives = 36/72 (50%) Frame = -3 Query: 317 LVSGVGHGVGDSIGADVRELPADGESFVL*AYVLQLTTFLVLDTVGSLITILESFHANVV 138 +V G + GD +G +R L D V+ + ++ D +G +IT+L V+ Sbjct: 291 VVQGETYRGGDDMGVVIRVLSDD--MGVVITVLSDDMGVVIRDDMGVVITVLSDDMGVVI 348 Query: 137 VVVSEDLRITIR 102 V+S+D+ + IR Sbjct: 349 TVLSDDMGVVIR 360 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 68 EFDIKLIDTVDLE 80 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 117 EFDIKLIDTVDLE 129 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) Length = 119 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 554 EFDIKLIDTVDLE 516 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_41282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 457 YDPDFNKPIYVLVTKKKKKNSRSTVSISLISNSARGADMSS 579 + PDF Y T +KK+ S+++++ N +RG+D S+ Sbjct: 338 FSPDFKVKCYFSETGEKKEKSKNSLTTEERRNRSRGSDDST 378 >SB_40017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 512 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 243 LAVSGQFSYVGPDGVTYSVTYTADEEGFKPSGAHLP 350 + + QF VGP V Y TY G +PSG+ P Sbjct: 268 MELDAQFVLVGPRLVRYGSTYPWTYSGTRPSGSTYP 303 >SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2839 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -3 Query: 605 QRLQRYTLLDDMSAPRAEFDIKLIDTVDLEXXXXXFVTK 489 Q R L + SAP +EFD KL+D V +E VT+ Sbjct: 846 QNRSRGILQREGSAPDSEFDPKLVDGVSVEIKREIEVTR 884 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +3 Query: 516 LEVDGIDKLDIEF 554 LE+DGIDKLDIEF Sbjct: 10 LELDGIDKLDIEF 22 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 516 LEVDGIDKLDIEFGTRRRHVV 578 LEVDGIDKLDI+ RR V+ Sbjct: 23 LEVDGIDKLDIDEYNIRRGVI 43 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 563 PRAEFDIKLIDTVDLE 516 P A+F IKLIDTVDLE Sbjct: 38 PSADFWIKLIDTVDLE 53 >SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 1/19 (5%) Frame = +3 Query: 516 LEVDGIDKLDIEF-GTRRR 569 LEVDGIDKLD+++ G R++ Sbjct: 23 LEVDGIDKLDVQYTGLRKK 41 >SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 519 EVDGIDKLDIEF 554 EVDGIDKLDIEF Sbjct: 26 EVDGIDKLDIEF 37 >SB_9511| Best HMM Match : DUF11 (HMM E-Value=0.097) Length = 812 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +3 Query: 156 GFQYGYETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADE 317 G+Q Y NG +Q SG N+ + + ++ + G D TY T T E Sbjct: 674 GYQLEYSIDNGANYQTSGLFTNLSAGTYKVNINAK---KGTDICTYQRTITISE 724 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 517 SRSTVSISLISNSARGAD 570 SRSTVSISLISNS D Sbjct: 25 SRSTVSISLISNSCSPGD 42 >SB_24692| Best HMM Match : Disintegrin (HMM E-Value=7.6e-23) Length = 1592 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +3 Query: 144 IGVEG-FQYGYETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTY 293 IG EG + G+ T + H E GQ N+ + ++ALA + F Y G T+ Sbjct: 322 IGTEGIYGEGHVTGYLLYHSEDGQRWNLFTGSDALA-NNSFCYRGKCASTH 371 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 517 SRSTVSISLISNSARGAD 570 SRSTVSISLISNS D Sbjct: 25 SRSTVSISLISNSCSPGD 42 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 517 SRSTVSISLISNSARGAD 570 SRSTVSISLISNS D Sbjct: 25 SRSTVSISLISNSCSPGD 42 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 517 SRSTVSISLISNSARGAD 570 SRSTVSISLISNS D Sbjct: 25 SRSTVSISLISNSCSPGD 42 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 517 SRSTVSISLISNSARGAD 570 SRSTVSISLISNS D Sbjct: 25 SRSTVSISLISNSCSPGD 42 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 517 SRSTVSISLISNSARGAD 570 SRSTVSISLISNS D Sbjct: 25 SRSTVSISLISNSCSPGD 42 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 517 SRSTVSISLISNSARGAD 570 SRSTVSISLISNS D Sbjct: 25 SRSTVSISLISNSCSPGD 42 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 517 SRSTVSISLISNSARGAD 570 SRSTVSISLISNS D Sbjct: 23 SRSTVSISLISNSCSPGD 40 >SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 575 DMSAPRAEFDIKLIDTVDLE 516 D + P + DIKLIDTVDLE Sbjct: 3 DNNNPVRKVDIKLIDTVDLE 22 >SB_44981| Best HMM Match : AA_permease (HMM E-Value=9.6e-13) Length = 446 Score = 27.5 bits (58), Expect = 9.0 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 3/87 (3%) Frame = -3 Query: 446 LRRCLITTDYIKVRRMSIFGLDVWIL*GDLSDWEVSTAGLESFLVSGVGHGVGDSIGADV 267 LRRCL T D + ++ G ++++ G+L+ A + SF ++ V + A+ Sbjct: 26 LRRCLNTFDLTSLGVGTVVGAGLYVVTGELARDVAGPAVVISFFIAAVAALLSGLCYAEF 85 Query: 266 -RELPADGESFVL*AYVL--QLTTFLV 195 +P G ++V YV +L F+V Sbjct: 86 GSRIPKAGSAYVY-TYVTLGELLAFIV 111 >SB_11966| Best HMM Match : adh_short (HMM E-Value=4.1e-32) Length = 728 Score = 27.5 bits (58), Expect = 9.0 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 3/87 (3%) Frame = -3 Query: 446 LRRCLITTDYIKVRRMSIFGLDVWIL*GDLSDWEVSTAGLESFLVSGVGHGVGDSIGADV 267 LRRCL T D + ++ G ++++ G+L+ A + SF ++ V + A+ Sbjct: 308 LRRCLNTFDLTSLGVGTVVGAGLYVVTGELARDVAGPAVVISFFIAAVAALLSGLCYAEF 367 Query: 266 -RELPADGESFVL*AYVL--QLTTFLV 195 +P G ++V YV +L F+V Sbjct: 368 GSRIPKAGSAYVY-TYVTLGELLAFIV 393 >SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) Length = 598 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 516 LEVDGIDKLDIEFGT 560 LEVDGIDKLD GT Sbjct: 94 LEVDGIDKLDFSDGT 108 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,645,888 Number of Sequences: 59808 Number of extensions: 274310 Number of successful extensions: 1221 Number of sequences better than 10.0: 103 Number of HSP's better than 10.0 without gapping: 1124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1216 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -