BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M18 (610 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 31 0.022 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 31 0.029 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 31 0.029 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 29 0.12 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 29 0.12 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 29 0.12 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 29 0.12 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 29 0.12 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 29 0.12 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 29 0.12 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 29 0.12 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 29 0.12 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 29 0.12 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 29 0.16 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 26 0.83 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 25 1.4 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 25 1.4 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 25 1.9 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 23 7.7 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 7.7 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 7.7 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 23 7.7 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 23 7.7 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 31.5 bits (68), Expect = 0.022 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +3 Query: 204 SGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTAD-EEGFKPSGAHLPVA 356 +G K+ + V G +S V PDG +V YTAD GF P+A Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVRREPLA 85 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 31.1 bits (67), Expect = 0.029 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 9/88 (10%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF------K 329 YE S + + +G +K+ V GQ+S + DG V Y AD GF + Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRRE 143 Query: 330 PSGAHL--PVA*ITLQNPNI*SKNTHSP 407 PS + PV + QN ++ S H+P Sbjct: 144 PSAVKIAQPVHKVIAQNVHV-SSYAHAP 170 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 31.1 bits (67), Expect = 0.029 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +KN V GQ+S + DG V Y AD GF Sbjct: 84 YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 29.1 bits (62), Expect = 0.12 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +K+ V GQ+S + DG V Y AD GF Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 29.1 bits (62), Expect = 0.12 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +K+ V GQ+S + DG V Y AD GF Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 29.1 bits (62), Expect = 0.12 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +K+ V GQ+S + DG V Y AD GF Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 29.1 bits (62), Expect = 0.12 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +K+ V GQ+S + DG V Y AD GF Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 29.1 bits (62), Expect = 0.12 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +K+ V GQ+S + DG V Y AD GF Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 29.1 bits (62), Expect = 0.12 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +K+ V GQ+S + DG V Y AD GF Sbjct: 116 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 168 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 29.1 bits (62), Expect = 0.12 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +K+ V GQ+S + DG V Y AD GF Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 29.1 bits (62), Expect = 0.12 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +K+ V GQ+S + DG V Y AD GF Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 29.1 bits (62), Expect = 0.12 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +K+ V GQ+S + DG V Y AD GF Sbjct: 84 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 29.1 bits (62), Expect = 0.12 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +K+ V GQ+S + DG V Y AD GF Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 28.7 bits (61), Expect = 0.16 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 171 YETSNGIQHQESGQLKNIGSENEALAVSGQFSYVGPDGVTYSVTYTADEE-GF 326 YE S + + +G +K+ V GQ+S + DG V Y AD GF Sbjct: 92 YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGF 144 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 26.2 bits (55), Expect = 0.83 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 262 SLTSAPMESPTP*PTPLTR-KDSSPAVLTSQS 354 +LTS+ S P P P TR SSP V TS S Sbjct: 732 ALTSSKSASTHPSPHPATRASPSSPIVATSSS 763 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.4 bits (53), Expect = 1.4 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 247 PSAGSSLTSAPMESPTP*PTPLTRKDSSPAVLTSQSLKSP 366 P+A SS TS+ P+P P TSQS + P Sbjct: 8 PTASSSTTSSSSSKPSPQQQQQLHSADVPHSSTSQSSRRP 47 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.4 bits (53), Expect = 1.4 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 247 PSAGSSLTSAPMESPTP*PTPLTRKDSSPAVLTSQSLKSP 366 P+A SS TS+ P+P P TSQS + P Sbjct: 8 PTASSSTTSSSSSKPSPQQQQQLHSADVPHSSTSQSSRRP 47 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.0 bits (52), Expect = 1.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 130 TTTTTLAWKDSNMVMRLPTVSST 198 TTTTT W DS P ++T Sbjct: 182 TTTTTTVWTDSTATTTTPASTTT 204 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 130 TTTTTLAWKDSNMVMRLPTVSST 198 TTTTT W D P ++T Sbjct: 182 TTTTTTVWTDPTATTTTPAPTTT 204 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 130 TTTTTLAWKDSNMVMRLPTVSST 198 TTTTT W D P ++T Sbjct: 182 TTTTTTVWTDPTATTTTPAPTTT 204 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 130 TTTTTLAWKDSNMVMRLPTVSST 198 TTTTT W D P ++T Sbjct: 181 TTTTTTVWTDPTATTTTPASTTT 203 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +1 Query: 130 TTTTTLAWKDSNMVMRLPTVSST 198 TTTTT W D P ++T Sbjct: 181 TTTTTTVWTDPTATTTTPASTTT 203 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 7.7 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 130 TTTTTLAWKDS--NMVMRLPTVSST 198 TTTTT W DS PT ++T Sbjct: 182 TTTTTTVWTDSTATTTTHAPTTTTT 206 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 525,735 Number of Sequences: 2352 Number of extensions: 8937 Number of successful extensions: 40 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -