BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M17 (606 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g32470.1 68418.m03828 expressed protein 29 1.8 At4g30130.1 68417.m04283 expressed protein contains Pfam domains... 28 5.5 At5g24540.1 68418.m02898 glycosyl hydrolase family 1 protein con... 27 7.3 At5g57380.1 68418.m07169 fibronectin type III domain-containing ... 27 9.6 At3g58060.1 68416.m06472 cation efflux family protein / metal to... 27 9.6 At1g59540.1 68414.m06694 kinesin motor protein-related similar t... 27 9.6 >At5g32470.1 68418.m03828 expressed protein Length = 575 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 120 RDAGFKAVESGFPFGCTLEQVKQAKENAGVEQVCINL 230 ++A + +ESG G LE +K+A E ++ CIN+ Sbjct: 407 KEANNRVIESGVLKGLNLEDIKRAGERLILQDGCINV 443 >At4g30130.1 68417.m04283 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 725 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +3 Query: 162 GCTLEQVKQAKENAGVEQVCINLKTGDTTKGEVGVTSVPGK 284 GC +E N E+ + + G TT VGVTS GK Sbjct: 248 GCKIENESDKNCNGTQERRSLEVSRGGTTGHVVGVTSDDGK 288 >At5g24540.1 68418.m02898 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to amygdalin hydrolase isoform AH I precursor (GI:16757966) [Prunus serotina] Length = 534 Score = 27.5 bits (58), Expect = 7.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 432 DVLKGESLLGLIEPINQYSMPNYFLSDYGRA 524 DV +G SL P+N+YS P +F D+G A Sbjct: 18 DVAQGRSLRFSTTPLNRYSFPPHF--DFGVA 46 >At5g57380.1 68418.m07169 fibronectin type III domain-containing protein / PHD finger protein-related contains Pfam profiles PF00041: Fibronectin type III domain, PF00628: PHD-finger Length = 600 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 162 GCTLEQVKQAKENAGVEQVCINLKTG 239 GC +QVK AKE V+ +C L G Sbjct: 191 GCWRKQVKVAKETRRVDVLCYRLSLG 216 >At3g58060.1 68416.m06472 cation efflux family protein / metal tolerance protein, putative (MTPc3) member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 411 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 434 IDSVLQIALESFPVLWRGFVHYAGHYMDFSCVH 336 I LQI LE P + R FVH +DF C H Sbjct: 370 IGESLQIKLEELPEVERAFVH-----LDFECHH 397 >At1g59540.1 68414.m06694 kinesin motor protein-related similar to kinesin motor protein (kin2) GI:2062751 from (Ustilago maydis) Length = 823 Score = 27.1 bits (57), Expect = 9.6 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 372 VDKPTPKHWETFESNLKYAVDVLKGES 452 +D P HWET NLK +L ++ Sbjct: 649 IDHPLSDHWETLRVNLKNTTTLLLSDA 675 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,367,591 Number of Sequences: 28952 Number of extensions: 252925 Number of successful extensions: 667 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -