BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M11 (272 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces... 30 0.051 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 26 1.1 SPAC630.08c |erg25||C-4 methylsterol oxidase|Schizosaccharomyces... 25 2.5 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 24 3.4 SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schiz... 24 3.4 SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|S... 24 3.4 SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 24 4.4 SPBC19C7.12c |||alpha-1,2-mannosyltransferase|Schizosaccharomyce... 23 7.8 SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces p... 23 7.8 SPBP8B7.21 |ubp3||ubiquitin C-terminal hydrolase Ubp3|Schizosacc... 23 7.8 SPBC713.07c |||vacuolar polyphosphatase |Schizosaccharomyces pom... 23 7.8 SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosacc... 23 7.8 SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizos... 23 7.8 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 23 7.8 >SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces pombe|chr 1|||Manual Length = 576 Score = 30.3 bits (65), Expect = 0.051 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 138 NSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPI 245 N V DG + VVI P F+ P+N S N+ P+ Sbjct: 402 NHSVTGDGEAKQVVITMPSTHFT-PANNSSANHSPL 436 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.8 bits (54), Expect = 1.1 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Frame = +3 Query: 198 FFSQPSNGP----SGNYEPISTGPAFVDF 272 F + P+N P SG+Y PI P F F Sbjct: 1560 FVTPPTNSPYAEVSGDYNPIHVSPTFAAF 1588 >SPAC630.08c |erg25||C-4 methylsterol oxidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 24.6 bits (51), Expect = 2.5 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = +1 Query: 40 FSSSPYWPWLPQTECTWSIITLIIIQARFTWWTIVVFH 153 F S P+ P T+ W I ++ + +W +FH Sbjct: 121 FGLSTSVPFPPVTKMIWQITLFFFLEDTWHYWAHRLFH 158 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 24.2 bits (50), Expect = 3.4 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +3 Query: 153 SDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 263 SD DH V + P F S+ P + E S P F Sbjct: 1443 SDVEDDHDVAKSTAPDFETSSHRPERSSEKKSPSPVF 1479 >SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1273 Score = 24.2 bits (50), Expect = 3.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 193 SGFAITTWSLLPSDGTPLL 137 S F + W++LP G P+L Sbjct: 899 SCFVLRIWNMLPETGVPIL 917 >SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|Schizosaccharomyces pombe|chr 3|||Manual Length = 624 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 173 RCYCEPGSFLLSTIKRS*RKL*THKHWTGVRR 268 +C EP S STI+ HW G+R+ Sbjct: 444 KCLTEPTSRFQSTIEIQKHPFFKRLHWNGLRK 475 >SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 262 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 150 PSDGNSDHVVIANPDPFFSQPSNGP 224 P+ GN D+ + P +SQPS P Sbjct: 85 PAVGNQDYSKPSYSQPSYSQPSQPP 109 >SPBC19C7.12c |||alpha-1,2-mannosyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 390 Score = 23.0 bits (47), Expect = 7.8 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +1 Query: 1 DNSDTIRQ*KLSCFSSSPYWPWLPQTECTWSIITL 105 DN DT+ +S S WLP + +TL Sbjct: 43 DNRDTLSYFNISNLEPSERSEWLPNKRVNAAFVTL 77 >SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +3 Query: 162 NSDHVVIANPDPFFSQPSNGP 224 N D++ ++ DP +++PS+ P Sbjct: 467 NGDNIEFSHFDPLYTRPSSHP 487 >SPBP8B7.21 |ubp3||ubiquitin C-terminal hydrolase Ubp3|Schizosaccharomyces pombe|chr 2|||Manual Length = 512 Score = 23.0 bits (47), Expect = 7.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 174 VVIANPDPFFSQPSNGPSGNYEPIS 248 V+I + FF + S G NY+PI+ Sbjct: 388 VLILHLKRFFYEASGGTQKNYKPIA 412 >SPBC713.07c |||vacuolar polyphosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 577 Score = 23.0 bits (47), Expect = 7.8 Identities = 18/63 (28%), Positives = 27/63 (42%) Frame = +3 Query: 81 VHVVDHNPDYNPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPA 260 +H+ D +PD + VD+ D NSD + + P GP YE + PA Sbjct: 50 LHITDMHPDIYYEKGSTVDHYCHSYDHNSDDTPLGKSKVGYLSP--GP--GYE-CDSSPA 104 Query: 261 FVD 269 +D Sbjct: 105 LID 107 >SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosaccharomyces pombe|chr 1|||Manual Length = 636 Score = 23.0 bits (47), Expect = 7.8 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +3 Query: 114 PGQVHVVDNSGVPSDGNSDHV--VIANPDPFFSQPSNGPSGNYEPIST 251 P + VV N P+ N HV V A+P+P S PSNGP+ P+ST Sbjct: 161 PHKAGVVSN---PAAANV-HVLSVAASPNP--STPSNGPA----PVST 198 >SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1338 Score = 23.0 bits (47), Expect = 7.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 171 HVVIANPDPFFSQPSNGPSGNY 236 HV ++NPD P + S NY Sbjct: 478 HVSLSNPDFAIGSPMSQDSSNY 499 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 23.0 bits (47), Expect = 7.8 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 150 PSDGNSDHVVIANPDPFFSQPSNGPSGNYE 239 P+D NS +V P + P+ P +YE Sbjct: 844 PADFNSLNVDFYEPHSYLESPAPEPQPSYE 873 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,154,561 Number of Sequences: 5004 Number of extensions: 21644 Number of successful extensions: 58 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 61 effective length of database: 2,057,234 effective search space used: 59659786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -