BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M11 (272 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0511 - 10079180-10079355,10079656-10079722,10080144-100801... 31 0.17 12_02_0216 + 15804110-15804284,15804341-15804351 30 0.29 10_05_0097 + 9145478-9145777,9146590-9146785,9146949-9147193 29 0.38 12_02_0219 + 15822050-15824896 27 1.5 11_01_0532 + 4201374-4201401,4201475-4202652,4204316-4204670,420... 27 1.5 12_01_0495 - 3935395-3937110 27 2.7 07_03_0380 + 17460078-17460782,17461194-17461252,17461388-174614... 27 2.7 04_03_0961 + 21263735-21263773,21264157-21264279,21266774-212668... 27 2.7 03_06_0327 - 33158131-33158315,33158586-33158639,33159149-331591... 27 2.7 03_02_0260 - 6924532-6924757,6925443-6925546,6925729-6926007,692... 27 2.7 01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 27 2.7 07_01_0601 + 4464745-4465010,4465274-4466582 26 3.6 03_05_0226 - 22115285-22115404,22115477-22116661,22117037-221178... 26 3.6 03_02_0259 - 6920472-6920579,6920744-6921022,6921115-6921390,692... 26 3.6 08_02_1553 + 27835320-27835364,27836853-27836966,27837062-278374... 26 4.7 05_01_0167 - 1153778-1153927,1154006-1154797,1155602-1156408,115... 26 4.7 04_01_0072 - 784922-785567,785673-786406 26 4.7 05_07_0334 - 29358823-29360247 25 6.3 05_05_0330 + 24137188-24137619 25 6.3 09_02_0234 - 6116931-6117052,6117549-6118369,6118573-6118601,611... 25 8.3 08_01_0364 - 3218309-3218414,3218882-3218941,3219898-3219969,322... 25 8.3 04_01_0536 - 6965343-6965537,6966407-6966595 25 8.3 03_02_0721 - 10677286-10678018,10679293-10679373,10682516-106826... 25 8.3 02_05_0237 + 27095817-27097433 25 8.3 01_07_0009 - 40397276-40397534,40397637-40398745,40398834-403989... 25 8.3 >09_02_0511 - 10079180-10079355,10079656-10079722,10080144-10080181, 10080255-10080336 Length = 120 Score = 30.7 bits (66), Expect = 0.17 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 81 VHVVDHNPDYNPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNG 221 V+ V + +PG +++N+G S GN ++ N PFF SNG Sbjct: 41 VYDVTSYVEEHPGGDEILNNAGATSKGNYALILPVNEFPFFLVYSNG 87 >12_02_0216 + 15804110-15804284,15804341-15804351 Length = 61 Score = 29.9 bits (64), Expect = 0.29 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +3 Query: 141 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 263 SG P+ +H V FF+ SN SGNY + G F Sbjct: 12 SGSPAPPYKNHTVAGADGWFFNATSNTTSGNYSDWAAGETF 52 >10_05_0097 + 9145478-9145777,9146590-9146785,9146949-9147193 Length = 246 Score = 29.5 bits (63), Expect = 0.38 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -1 Query: 155 RWNTT--IVHHVNLAWIIIRVMIDHVHSVCGSHGQYGEEEKHESFHCRIVSEL 3 RWNTT ++H + II V ID +H + G+E +H+ +V + Sbjct: 128 RWNTTYLMLHQLKGYEKIISVFIDSLHFRSNDTDEDGDENRHDRVLAYVVQPM 180 >12_02_0219 + 15822050-15824896 Length = 948 Score = 27.5 bits (58), Expect = 1.5 Identities = 10/39 (25%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 1 DNSDTIRQ*KLSC-FSSSPYWPWLPQTECTWSIITLIII 114 D D +R+ ++ C F+ P WPWL +++ +++ Sbjct: 269 DFGDPLRKHEMHCRFTQGPPWPWLAVASSYGTLVISLLV 307 >11_01_0532 + 4201374-4201401,4201475-4202652,4204316-4204670, 4204791-4204864,4206965-4207056,4207500-4207573, 4207680-4207822,4207889-4207909 Length = 654 Score = 27.5 bits (58), Expect = 1.5 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +3 Query: 93 DHNPDYNPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGP 257 DH+ D + V+ D+S VP D + D + DP + EP+S P Sbjct: 40 DHSDDSDSAAVNEDDDSAVPEDAD-DETLAGAEDPVLDLREAEVLPSAEPVSAFP 93 >12_01_0495 - 3935395-3937110 Length = 571 Score = 26.6 bits (56), Expect = 2.7 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +3 Query: 93 DHNPDYNPGQVHVVDNSGVPSDGNSD--HVVIANPDP 197 DH Y+ HVVD P G D HV +A P P Sbjct: 342 DHYLGYHSHDAHVVDAEATPEQGYHDDAHVAVA-PAP 377 >07_03_0380 + 17460078-17460782,17461194-17461252,17461388-17461492, 17461732-17461867,17461919-17461939 Length = 341 Score = 26.6 bits (56), Expect = 2.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 84 HVVDHNPDYNPGQVHVVDNSGVPSDGNSDHVVIA 185 H+V+ P + G+ V + VP DG +H+V++ Sbjct: 282 HIVERKP-FRCGRYPPVVRTAVPVDGRFEHIVLS 314 >04_03_0961 + 21263735-21263773,21264157-21264279,21266774-21266847, 21266939-21267095,21267554-21267694,21267739-21267823, 21268810-21268903,21269041-21269239,21269515-21269549, 21270076-21270631,21270722-21270882,21271704-21271718, 21273078-21273330,21273439-21273562,21273688-21273788, 21274870-21274938,21275060-21275191,21275270-21275404, 21275489-21275551,21275636-21275881,21276007-21276285 Length = 1026 Score = 26.6 bits (56), Expect = 2.7 Identities = 11/54 (20%), Positives = 24/54 (44%) Frame = +3 Query: 87 VVDHNPDYNPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPIS 248 ++ P+ G + + N+G+P +S N +P + + N EP++ Sbjct: 340 LIKDEPNTQDGNNNTIQNTGIPIIASSSEFTPMNVEPSIASSNEFTPMNVEPLN 393 >03_06_0327 - 33158131-33158315,33158586-33158639,33159149-33159180, 33159275-33159369,33159466-33159539,33159643-33159778, 33159874-33159937,33160017-33160079,33160160-33160299, 33160487-33160627,33160747-33160868,33160947-33161112, 33161194-33161313,33161580-33161651,33161787-33161843, 33162036-33162152,33162231-33162369,33162794-33162900, 33162972-33163081,33163172-33163305,33163397-33163546, 33163635-33163840,33166123-33166818 Length = 1059 Score = 26.6 bits (56), Expect = 2.7 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = +3 Query: 96 HNPDYNPGQVHVVDNSGVPSDG---NSDHVVIANPDPFFSQPSNGPSGNYEPISTGPA 260 H Y PG V+ + GVP G S V I P P S+ P+ Y+P + PA Sbjct: 83 HQGAYQPGGVYRAPSPGVPVIGGYARSTPVTIRAPPP---SHSSAPA-PYQPAAAAPA 136 >03_02_0260 - 6924532-6924757,6925443-6925546,6925729-6926007, 6926093-6926368,6926460-6926678,6926758-6926926, 6927208-6927382,6927489-6927600,6929566-6929820 Length = 604 Score = 26.6 bits (56), Expect = 2.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 129 VVDNSGVPSDGNSDHVVIANPDPFFSQP 212 V++N +P N HVV+ANP P P Sbjct: 248 VLENCQLPH-ANHGHVVLANPSPILFYP 274 >01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 Length = 580 Score = 26.6 bits (56), Expect = 2.7 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +3 Query: 141 SGVPSD-GNSDHVVIANPDPFF-SQPSNGPSGNYEPIST 251 SG PS GN+ + ++P PF S PS+G SGNY + T Sbjct: 464 SGSPSHRGNAG--MKSSPSPFAPSGPSSGGSGNYGRLPT 500 >07_01_0601 + 4464745-4465010,4465274-4466582 Length = 524 Score = 26.2 bits (55), Expect = 3.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 165 SDHVVIANPDPFFSQPSNGPSGNYEPISTGPA 260 SDH V+ P PF P++ + + PI T PA Sbjct: 50 SDHFVLT-PPPFQITPTSIQNSTWLPIPTSPA 80 >03_05_0226 - 22115285-22115404,22115477-22116661,22117037-22117861, 22118029-22118106,22118370-22118420,22118510-22118581, 22118666-22118667,22119453-22119557,22119668-22119749, 22120178-22120227,22120514-22120567,22121084-22121164, 22121567-22121656,22121884-22121964,22122304-22122544 Length = 1038 Score = 26.2 bits (55), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 140 IVHHVNLAWIIIRVMIDHVHSV 75 ++ NL W IIRV +DH H + Sbjct: 482 VISKRNLIWRIIRVNLDHNHKM 503 >03_02_0259 - 6920472-6920579,6920744-6921022,6921115-6921390, 6921473-6921691,6921795-6921963,6922248-6922422, 6922490-6922601,6923343-6923573 Length = 522 Score = 26.2 bits (55), Expect = 3.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 129 VVDNSGVPSDGNSDHVVIANPDPFFSQP 212 V++N +P N HV++ANP P P Sbjct: 240 VLENCQLPHP-NHGHVILANPSPILCYP 266 >08_02_1553 + 27835320-27835364,27836853-27836966,27837062-27837457, 27837751-27837822,27837957-27838082,27838164-27838244, 27838364-27838558,27839018-27840013 Length = 674 Score = 25.8 bits (54), Expect = 4.7 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = +3 Query: 99 NPDYNPGQVHVVDN--SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFV 266 NP + +V +N + V D + V P P ++P G G +P + P F+ Sbjct: 521 NPMFQSATSYVRENRRASVVWDQEAGRYVSVAPAPATARPGGGGGGAEQPAARAPPFL 578 >05_01_0167 - 1153778-1153927,1154006-1154797,1155602-1156408, 1156514-1156618,1156985-1157059,1157160-1157233, 1157388-1157450,1157549-1157647,1157704-1157811, 1157908-1157973,1158073-1158150,1158257-1158304, 1158381-1158440,1158527-1158610,1158902-1158949, 1159049-1159096,1161462-1161579 Length = 940 Score = 25.8 bits (54), Expect = 4.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 140 IVHHVNLAWIIIRVMIDHVHSV 75 ++ NL WII R+ +DH H + Sbjct: 505 VISERNLEWIITRLDLDHNHEL 526 >04_01_0072 - 784922-785567,785673-786406 Length = 459 Score = 25.8 bits (54), Expect = 4.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +3 Query: 198 FFSQPSNGP--SGNYEPISTGPAFVD 269 FFS+PS GP SGN++ + +D Sbjct: 66 FFSRPSKGPTVSGNFDYLPCSSCIID 91 >05_07_0334 - 29358823-29360247 Length = 474 Score = 25.4 bits (53), Expect = 6.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 116 WIIIRVMIDHVHSVCGSHGQYG 51 W +R M+ CGS GQYG Sbjct: 417 WECLRSMVRTFEDQCGSLGQYG 438 >05_05_0330 + 24137188-24137619 Length = 143 Score = 25.4 bits (53), Expect = 6.3 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 102 GYDRPRALCLRQPWP 58 G RP LC R PWP Sbjct: 78 GVVRPSPLCARTPWP 92 >09_02_0234 - 6116931-6117052,6117549-6118369,6118573-6118601, 6118711-6119020,6119469-6119476,6120104-6120232, 6120341-6120445 Length = 507 Score = 25.0 bits (52), Expect = 8.3 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 93 DHNPDYNPGQVHVVDNSGVPSDGNSDH 173 + N DYNP + V D+ S ++DH Sbjct: 273 EDNIDYNPEMIGVADDQHSISSDDTDH 299 >08_01_0364 - 3218309-3218414,3218882-3218941,3219898-3219969, 3220080-3223195,3223303-3223561,3223665-3223951, 3224029-3224364,3224463-3224604,3224690-3224910, 3224990-3225151,3225242-3225400,3225488-3225787, 3226306-3226569,3227370-3227453 Length = 1855 Score = 25.0 bits (52), Expect = 8.3 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Frame = +3 Query: 99 NPDYNPGQVHVVDNSGVPSDGNSDHVVIANPDPFFS--QPSNGPSGNYEPISTG 254 +P Y+P S S S + P P +S P+ PSG+Y P + G Sbjct: 1780 SPTYSPTSPSYSQPSPSYSP-TSPYTTSGGPSPDYSPTSPNYSPSGSYSPTAPG 1832 >04_01_0536 - 6965343-6965537,6966407-6966595 Length = 127 Score = 25.0 bits (52), Expect = 8.3 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 216 NGPSGNYEPISTG 254 NGP+GNYE I G Sbjct: 102 NGPTGNYEGIGAG 114 >03_02_0721 - 10677286-10678018,10679293-10679373,10682516-10682645, 10682969-10683101 Length = 358 Score = 25.0 bits (52), Expect = 8.3 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 153 SDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGP 257 SD V+ +P+ SQP+NG SG GP Sbjct: 213 SDEARSGSVVVDPEEPSSQPNNGSSGGGGGTPDGP 247 >02_05_0237 + 27095817-27097433 Length = 538 Score = 25.0 bits (52), Expect = 8.3 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -3 Query: 171 GHYCRPMEHHYCPPREPGLDYNQGY---DRPRALCLR 70 GH HH PPR P L + G RPR L R Sbjct: 20 GHRIEVKSHHASPPRLPLLPRSPGLTLASRPRMLPAR 56 >01_07_0009 - 40397276-40397534,40397637-40398745,40398834-40398932, 40399043-40399272,40399534-40399585,40399679-40399865, 40399987-40400193,40400283-40400449,40400804-40401094, 40401166-40401636 Length = 1023 Score = 25.0 bits (52), Expect = 8.3 Identities = 10/35 (28%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 10 DTIRQ*KLSC-FSSSPYWPWLPQTECTWSIITLII 111 D R+ ++ C F P WPWL T +++ ++ Sbjct: 369 DPSRKHEMHCRFEKKPPWPWLAITSSFGTLVIALL 403 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,021,055 Number of Sequences: 37544 Number of extensions: 165127 Number of successful extensions: 420 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 14,793,348 effective HSP length: 69 effective length of database: 12,202,812 effective search space used: 256259052 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -