BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M11 (272 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 23 2.0 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 21 6.2 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 21 6.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 21 6.2 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 21 8.3 AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 21 8.3 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 21 8.3 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 21 8.3 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 21 8.3 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 21 8.3 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 21 8.3 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 21 8.3 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 21 8.3 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 21 8.3 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 21 8.3 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 21 8.3 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 21 8.3 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 21 8.3 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 21 8.3 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 21 8.3 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 21 8.3 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 21 8.3 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 23.0 bits (47), Expect = 2.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 11 TLFDNESFRVFLLRRIGHGCRKQS 82 TLFD E F VF + G KQS Sbjct: 319 TLFDREGFAVFRDHKSMLGALKQS 342 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 21.4 bits (43), Expect = 6.2 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = +1 Query: 64 WLPQTECTWSIITLI 108 WL + CTW + L+ Sbjct: 805 WLMKVACTWDDVKLL 819 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +2 Query: 5 TLTLFDNESFRVFLLRRIGHG 67 +L +F+N+ F L + + HG Sbjct: 388 SLKIFNNQEFAQLLSQSVNHG 408 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/32 (28%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -1 Query: 95 IDH-VHSVCGSHGQYGEEEKHESFHCRIVSEL 3 I H + +CG + +EK E+F ++ L Sbjct: 2733 ISHGLEQICGGSADFPSQEKAENFLMHLLMPL 2764 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 135 PPREPGLDYN 106 PP PGLDY+ Sbjct: 2493 PPCSPGLDYD 2502 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +3 Query: 189 PDPFFSQPSNGPSGNYEPI 245 P P P GP+G+ P+ Sbjct: 595 PSPLAGGPLGGPAGSRPPL 613 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 21.0 bits (42), Expect = 8.3 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +3 Query: 141 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGP 257 S + +D N +V D Q N P+ + PIS+ P Sbjct: 102 STLGADSNFGSLVNGAVDTCARQIQNDPAYSVAPISSSP 140 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 122 GSRGGQ*WCSIGRQ 163 G GGQ CSI RQ Sbjct: 504 GGAGGQHACSIARQ 517 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -1 Query: 89 HVHSVCGSHGQYGEEEKHES 30 HVH + HG Y + H + Sbjct: 43 HVHMMPEMHGAYSQVHHHRA 62 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -1 Query: 89 HVHSVCGSHGQYGEEEKHES 30 HVH + HG Y + H + Sbjct: 43 HVHMMPEMHGAYSQVHHHRA 62 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 194 HYAAPIAHHAAP 205 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 196 HYAAPIAHHAAP 207 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 232 HYAAPIAHHAAP 243 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 194 HYAAPIAHHAAP 205 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 168 HYCRPMEHHYCP 133 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 306,747 Number of Sequences: 2352 Number of extensions: 6270 Number of successful extensions: 38 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 54 effective length of database: 436,971 effective search space used: 15730956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -