BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M09 (103 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 2e-04 SB_9863| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 >SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 40.7 bits (91), Expect = 2e-04 Identities = 20/38 (52%), Positives = 28/38 (73%), Gaps = 4/38 (10%) Frame = +1 Query: 1 ADQTEKAFQKQATVFLNRKGGM----KRKDMRHSKNVG 102 A+QTE+A+QKQA +F NRK + K+KD+R +NVG Sbjct: 2 AEQTERAYQKQAPIFQNRKRVLGQVTKKKDLRFVRNVG 39 >SB_9863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 25.8 bits (54), Expect = 5.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 54 QGGHEKEGYETF*ECW 101 QGGH+ G + F ECW Sbjct: 44 QGGHKYVGIQFFAECW 59 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.127 0.347 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,125,272 Number of Sequences: 59808 Number of extensions: 32555 Number of successful extensions: 97 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 16,821,457 effective HSP length: 14 effective length of database: 15,984,145 effective search space used: 303698755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -