Samia BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0001_M09
         (103 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z73426-1|CAA97792.1|  155|Caenorhabditis elegans Hypothetical pr...    29   0.33 

>Z73426-1|CAA97792.1|  155|Caenorhabditis elegans Hypothetical
           protein F40F11.1 protein.
          Length = 155

 Score = 29.5 bits (63), Expect = 0.33
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 3/37 (8%)
 Frame = +1

Query: 1   ADQTEKAFQKQATVFLNRKGGM---KRKDMRHSKNVG 102
           ++QTE+AF KQ TV LN K  +    +K  R+ + VG
Sbjct: 2   SEQTERAFLKQPTVNLNNKARILAGSKKTPRYIREVG 38


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.315    0.127    0.347 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,331,088
Number of Sequences: 27780
Number of extensions: 25509
Number of successful extensions: 84
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 83
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 84
length of database: 12,740,198
effective HSP length: 15
effective length of database: 12,323,498
effective search space used: 221822964
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)