BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M08 (279 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752906-1|AAV30080.1| 116|Anopheles gambiae peroxidase 12 prot... 23 1.6 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 2.2 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 21 8.7 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 21 8.7 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 21 8.7 >AY752906-1|AAV30080.1| 116|Anopheles gambiae peroxidase 12 protein. Length = 116 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +2 Query: 188 TDGVNCRYRKQKYEISCWKLGN 253 TDG++CR + +I+C+ G+ Sbjct: 30 TDGMDCRRDLDESQINCFTAGD 51 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +2 Query: 158 TLKLGDNTRVTDGVNCRYRKQKYEISCWKLGNGTFRLGG 274 +L R T+G+ +K K ++ LG G + GG Sbjct: 998 SLNFQTRNRATEGIGRSIQKAKRRLNRLGLGKGKKKTGG 1036 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 162 NVIWSTLDTASPKFISFKSACFLNYFEITF 73 +V W L+ + + F + C Y +ITF Sbjct: 206 SVEWDILEVPAVRNEKFYTCCDEPYLDITF 235 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 162 NVIWSTLDTASPKFISFKSACFLNYFEITF 73 +V W L+ + + F + C Y +ITF Sbjct: 206 SVEWDILEVPAVRNEKFYTCCDEPYLDITF 235 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 162 NVIWSTLDTASPKFISFKSACFLNYFEITF 73 +V W L+ + + F + C Y +ITF Sbjct: 202 SVEWDILEVPAVRNEKFYTCCDEPYLDITF 231 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 300,155 Number of Sequences: 2352 Number of extensions: 5236 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 54 effective length of database: 436,971 effective search space used: 16604898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -