BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M08 (279 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC125162-1|AAI25163.1| 544|Homo sapiens NBPF4 protein protein. 28 6.1 BC125161-1|AAI25162.1| 573|Homo sapiens NBPF4 protein protein. 28 6.1 BC050328-1|AAH50328.2| 290|Homo sapiens neuroblastoma breakpoin... 28 6.1 AL392088-1|CAI23469.1| 649|Homo sapiens novel protein similar t... 28 6.1 AL390038-2|CAH70399.1| 649|Homo sapiens novel protein similar t... 28 6.1 AL359258-3|CAI14514.1| 638|Homo sapiens novel protein protein. 28 6.1 Z98050-1|CAI21070.1| 2717|Homo sapiens human immunodeficiency vi... 27 8.0 X51435-1|CAA35798.1| 2717|Homo sapiens protein ( Human PRDII-BF1... 27 8.0 U03486-1|AAA60457.2| 358|Homo sapiens connexin40 protein. 27 8.0 L34954-1|AAA91833.1| 358|Homo sapiens connexin 40 protein. 27 8.0 BT019416-1|AAV38223.1| 358|Homo sapiens gap junction protein, a... 27 8.0 BT019415-1|AAV38222.1| 358|Homo sapiens gap junction protein, a... 27 8.0 BC013313-1|AAH13313.1| 358|Homo sapiens GJA5 protein protein. 27 8.0 AL391828-1|CAH73909.1| 2717|Homo sapiens human immunodeficiency ... 27 8.0 AL365260-2|CAI14125.1| 252|Homo sapiens gap junction protein, a... 27 8.0 AL365260-1|CAI14124.1| 358|Homo sapiens gap junction protein, a... 27 8.0 AL157373-1|CAH73982.1| 2717|Homo sapiens human immunodeficiency ... 27 8.0 AL137221-1|CAI14768.1| 2717|Homo sapiens human immunodeficiency ... 27 8.0 AF151979-1|AAD37801.1| 358|Homo sapiens connexin 40 protein. 27 8.0 >BC125162-1|AAI25163.1| 544|Homo sapiens NBPF4 protein protein. Length = 544 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 201 LTPSVTRVLSPNFNVIWSTLDTASPKFIS 115 LTPS+ L+P+++ WSTL + K +S Sbjct: 366 LTPSILPDLTPSYHPYWSTLYSFEDKQVS 394 >BC125161-1|AAI25162.1| 573|Homo sapiens NBPF4 protein protein. Length = 573 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 201 LTPSVTRVLSPNFNVIWSTLDTASPKFIS 115 LTPS+ L+P+++ WSTL + K +S Sbjct: 395 LTPSILPDLTPSYHPYWSTLYSFEDKQVS 423 >BC050328-1|AAH50328.2| 290|Homo sapiens neuroblastoma breakpoint family, member 22 (pseudogene) protein. Length = 290 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 201 LTPSVTRVLSPNFNVIWSTLDTASPKFIS 115 LTPS+ L+P+++ WSTL + K +S Sbjct: 100 LTPSILPDLTPSYHPYWSTLYSFEDKQVS 128 >AL392088-1|CAI23469.1| 649|Homo sapiens novel protein similar to FLJ32883 containing DUF1220 domains protein. Length = 649 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 201 LTPSVTRVLSPNFNVIWSTLDTASPKFIS 115 LTPS+ L+P+++ WSTL + K +S Sbjct: 377 LTPSILPDLTPSYHPYWSTLYSFEDKQVS 405 >AL390038-2|CAH70399.1| 649|Homo sapiens novel protein similar to FLJ32883 containing DUF1220 domains protein. Length = 649 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 201 LTPSVTRVLSPNFNVIWSTLDTASPKFIS 115 LTPS+ L+P+++ WSTL + K +S Sbjct: 377 LTPSILPDLTPSYHPYWSTLYSFEDKQVS 405 >AL359258-3|CAI14514.1| 638|Homo sapiens novel protein protein. Length = 638 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 201 LTPSVTRVLSPNFNVIWSTLDTASPKFIS 115 LTPS+ L+P+++ WSTL + K +S Sbjct: 366 LTPSILPDLTPSYHPYWSTLYSFEDKQVS 394 >Z98050-1|CAI21070.1| 2717|Homo sapiens human immunodeficiency virus type I enhancer binding protein 1 protein. Length = 2717 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 274 SSKPKCPITQLPTGYFVFLLSIPAIDSISHT 182 S PK P T VFLLS+P++D + T Sbjct: 807 SDIPKSPFTPTEKSKQVFLLSVPSLDCLPIT 837 >X51435-1|CAA35798.1| 2717|Homo sapiens protein ( Human PRDII-BF1 gene for a DNA-binding protein. ). Length = 2717 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 274 SSKPKCPITQLPTGYFVFLLSIPAIDSISHT 182 S PK P T VFLLS+P++D + T Sbjct: 806 SDIPKSPFTPTEKSKQVFLLSVPSLDCLPIT 836 >U03486-1|AAA60457.2| 358|Homo sapiens connexin40 protein. Length = 358 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 218 QKYEISCWKLGNGTFRLGG 274 +K E+SCW+ GNG L G Sbjct: 129 EKAELSCWEEGNGRIALQG 147 >L34954-1|AAA91833.1| 358|Homo sapiens connexin 40 protein. Length = 358 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 218 QKYEISCWKLGNGTFRLGG 274 +K E+SCW+ GNG L G Sbjct: 129 EKAELSCWEEGNGRIALQG 147 >BT019416-1|AAV38223.1| 358|Homo sapiens gap junction protein, alpha 5, 40kDa (connexin 40) protein. Length = 358 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 218 QKYEISCWKLGNGTFRLGG 274 +K E+SCW+ GNG L G Sbjct: 129 EKAELSCWEEGNGRIALQG 147 >BT019415-1|AAV38222.1| 358|Homo sapiens gap junction protein, alpha 5, 40kDa (connexin 40) protein. Length = 358 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 218 QKYEISCWKLGNGTFRLGG 274 +K E+SCW+ GNG L G Sbjct: 129 EKAELSCWEEGNGRIALQG 147 >BC013313-1|AAH13313.1| 358|Homo sapiens GJA5 protein protein. Length = 358 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 218 QKYEISCWKLGNGTFRLGG 274 +K E+SCW+ GNG L G Sbjct: 129 EKAELSCWEEGNGRIALQG 147 >AL391828-1|CAH73909.1| 2717|Homo sapiens human immunodeficiency virus type I enhancer binding protein 1 protein. Length = 2717 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 274 SSKPKCPITQLPTGYFVFLLSIPAIDSISHT 182 S PK P T VFLLS+P++D + T Sbjct: 807 SDIPKSPFTPTEKSKQVFLLSVPSLDCLPIT 837 >AL365260-2|CAI14125.1| 252|Homo sapiens gap junction protein, alpha 5, 40kDa protein. Length = 252 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 218 QKYEISCWKLGNGTFRLGG 274 +K E+SCW+ GNG L G Sbjct: 129 EKAELSCWEEGNGRIALQG 147 >AL365260-1|CAI14124.1| 358|Homo sapiens gap junction protein, alpha 5, 40kDa protein. Length = 358 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 218 QKYEISCWKLGNGTFRLGG 274 +K E+SCW+ GNG L G Sbjct: 129 EKAELSCWEEGNGRIALQG 147 >AL157373-1|CAH73982.1| 2717|Homo sapiens human immunodeficiency virus type I enhancer binding protein 1 protein. Length = 2717 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 274 SSKPKCPITQLPTGYFVFLLSIPAIDSISHT 182 S PK P T VFLLS+P++D + T Sbjct: 807 SDIPKSPFTPTEKSKQVFLLSVPSLDCLPIT 837 >AL137221-1|CAI14768.1| 2717|Homo sapiens human immunodeficiency virus type I enhancer binding protein 1 protein. Length = 2717 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 274 SSKPKCPITQLPTGYFVFLLSIPAIDSISHT 182 S PK P T VFLLS+P++D + T Sbjct: 807 SDIPKSPFTPTEKSKQVFLLSVPSLDCLPIT 837 >AF151979-1|AAD37801.1| 358|Homo sapiens connexin 40 protein. Length = 358 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 218 QKYEISCWKLGNGTFRLGG 274 +K E+SCW+ GNG L G Sbjct: 129 EKAELSCWEEGNGRIALQG 147 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,088,173 Number of Sequences: 237096 Number of extensions: 699780 Number of successful extensions: 1317 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1317 length of database: 76,859,062 effective HSP length: 70 effective length of database: 60,262,342 effective search space used: 1325771524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -