BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M08 (279 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 1.6 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 2.8 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 2.8 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 2.8 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 3.7 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 20 6.5 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 19 8.6 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 19 8.6 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 1.6 Identities = 6/19 (31%), Positives = 14/19 (73%) Frame = +1 Query: 49 PHLVGVPNESDFKIVEEAC 105 PH++G ++ +++V +AC Sbjct: 341 PHMLGGRTDTTYRVVCDAC 359 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.0 bits (42), Expect = 2.8 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 162 NVIWSTLDTASPKFISFKSACFLNYFEITF 73 +V W L+ + + F + C Y +ITF Sbjct: 207 SVEWDILEVPAVRNEKFYTCCDEPYLDITF 236 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.0 bits (42), Expect = 2.8 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 162 NVIWSTLDTASPKFISFKSACFLNYFEITF 73 +V W L+ + + F + C Y +ITF Sbjct: 207 SVEWDILEVPAVRNEKFYTCCDEPYLDITF 236 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.0 bits (42), Expect = 2.8 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 162 NVIWSTLDTASPKFISFKSACFLNYFEITF 73 +V W L+ + + F + C Y +ITF Sbjct: 203 SVEWDILEVPAVRNEKFYTCCDEPYLDITF 232 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 20.6 bits (41), Expect = 3.7 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +2 Query: 146 VDHITLKLGDNTRV 187 V+HI+ ++GDN + Sbjct: 317 VNHISARVGDNVEI 330 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 19.8 bits (39), Expect = 6.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 165 NWEIIPV*LMESIAGIESRNTKYPV 239 N+ +I V + I I RN++YP+ Sbjct: 101 NFPMISVFSRQDIETIIRRNSRYPL 125 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 19.4 bits (38), Expect = 8.6 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 176 NTRVTDGVNCRYRKQKY 226 NTR+ +NC R +K+ Sbjct: 133 NTRLQATLNCGLRLEKF 149 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 19.4 bits (38), Expect = 8.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 235 GYFVFLLSIPAI 200 GYFVF +P+I Sbjct: 242 GYFVFQTYLPSI 253 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,544 Number of Sequences: 438 Number of extensions: 1617 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 5369883 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -