BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M04 (501 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20H4.05c |||adducin|Schizosaccharomyces pombe|chr 1|||Manual 75 6e-15 SPAC9.06c |||adducin|Schizosaccharomyces pombe|chr 1|||Manual 30 0.17 SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe... 25 6.4 >SPAC20H4.05c |||adducin|Schizosaccharomyces pombe|chr 1|||Manual Length = 221 Score = 74.9 bits (176), Expect = 6e-15 Identities = 45/103 (43%), Positives = 58/103 (56%), Gaps = 1/103 (0%) Frame = +3 Query: 159 LIPELCKQFYHLGWVTGTGGGISIKEGDRIYIAPSGVQKERMKSDDLFVQTIHDVDXXXX 338 LI E+C+ Y GWVTGTG D I IAPSGVQKERM+ LFV ++ + Sbjct: 23 LICEICRDLYTSGWVTGTG--------DAIVIAPSGVQKERMELHHLFVMSLITRE-YMR 73 Query: 339 XXXXXXXXSQCTPLFMLAYI-MRNAGSVIHTHSPHAVRCTLLY 464 SQCTPLF+ Y +R+A + IHTHS A+ + L+ Sbjct: 74 MPALRLKPSQCTPLFLAVYTSLRDAYACIHTHSQEAILLSTLF 116 >SPAC9.06c |||adducin|Schizosaccharomyces pombe|chr 1|||Manual Length = 192 Score = 30.3 bits (65), Expect = 0.17 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +3 Query: 153 RNLIPELCKQFYHLGWVT-GTGGGISIKE 236 +NLI EL FY LGW+ G+G I +K+ Sbjct: 7 KNLILELIPHFYSLGWMKFGSGYAICVKD 35 >SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1465 Score = 25.0 bits (52), Expect = 6.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 228 IKEGDRIYIAPSGVQKERMKSDDLFVQT 311 +KE D IYI +G E+ + LFV T Sbjct: 768 LKEADSIYILSNGKIVEKGNYEHLFVST 795 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,108,507 Number of Sequences: 5004 Number of extensions: 41147 Number of successful extensions: 95 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -