BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M03 (552 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25829| Best HMM Match : No HMM Matches (HMM E-Value=.) 128 4e-30 SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) 99 3e-21 SB_5072| Best HMM Match : Aldedh (HMM E-Value=2.4e-14) 69 3e-12 SB_37963| Best HMM Match : Aldedh (HMM E-Value=1.8e-16) 54 1e-07 SB_12802| Best HMM Match : Aldedh (HMM E-Value=0) 53 2e-07 SB_58786| Best HMM Match : Aldedh (HMM E-Value=0) 52 2e-07 SB_32909| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 5e-07 SB_57708| Best HMM Match : Aldedh (HMM E-Value=0) 48 7e-06 SB_15907| Best HMM Match : Aldedh (HMM E-Value=3.2e-23) 47 9e-06 SB_19772| Best HMM Match : Aldedh (HMM E-Value=5.9e-12) 45 5e-05 SB_52935| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_26122| Best HMM Match : Aldedh (HMM E-Value=0) 33 0.21 SB_42352| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_47411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_22798| Best HMM Match : Cadherin (HMM E-Value=0) 28 5.8 SB_17577| Best HMM Match : fn3 (HMM E-Value=0) 27 7.7 >SB_25829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 128 bits (308), Expect = 4e-30 Identities = 64/138 (46%), Positives = 81/138 (58%) Frame = +3 Query: 18 KLFINNEWVDAVSKKTFPTINPQDESVIVQVAEGXXXXXXXXXXXXXXXFHRYSEWRLLD 197 +LFINNE+VD S K FPTINP I ++EG F S WR +D Sbjct: 331 ELFINNEFVDCTSGKVFPTINPTTGEKICDISEGDKEDVDKAVKAAKEAFKLGSAWRTMD 390 Query: 198 ASQRGLLLFKLATLMERDAKYLAELETLDNGKPVKQAEQEVLWASGIVRYYAGKADKILG 377 AS RG LL+KLA L++RD YLA LET+D+GK + ++ ++ RYYAG ADK+ G Sbjct: 391 ASMRGKLLYKLAQLIDRDIAYLASLETIDSGKLFSDSVGDMQSSANCFRYYAGWADKVTG 450 Query: 378 NTIPADGEVLTFTLKEPV 431 TIPADG +T EPV Sbjct: 451 KTIPADGPYFVYTRHEPV 468 Score = 52.4 bits (120), Expect = 2e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = +2 Query: 440 GQILPWNYPIPMFIWNIAPALAAGCTVVVKPAEQTPL 550 G I PWN+P+ M IAPALA G V++KPAEQTPL Sbjct: 472 GAITPWNFPLNMASVKIAPALACGNVVILKPAEQTPL 508 >SB_10421| Best HMM Match : Guanylate_cyc (HMM E-Value=0) Length = 1485 Score = 98.7 bits (235), Expect = 3e-21 Identities = 48/85 (56%), Positives = 57/85 (67%) Frame = +3 Query: 177 SEWRLLDASQRGLLLFKLATLMERDAKYLAELETLDNGKPVKQAEQEVLWASGIVRYYAG 356 S WR +DAS RG L+KLA L ERDA YLA LE+ D GK + +A+ +V G RYYAG Sbjct: 1254 SVWRTMDASARGHFLYKLADLCERDADYLARLESYDGGKVINEAKIDVQGMIGCFRYYAG 1313 Query: 357 KADKILGNTIPADGEVLTFTLKEPV 431 ADK+ G TIPADG T+T EPV Sbjct: 1314 WADKVTGKTIPADGPFFTYTRHEPV 1338 Score = 56.4 bits (130), Expect = 1e-08 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +2 Query: 434 VCGQILPWNYPIPMFIWNIAPALAAGCTVVVKPAEQTPL 550 V G I PWN+P+ M +APALA GC V++KPAEQTPL Sbjct: 1340 VVGAITPWNFPLLMEGLKLAPALACGCVVILKPAEQTPL 1378 >SB_5072| Best HMM Match : Aldedh (HMM E-Value=2.4e-14) Length = 266 Score = 68.9 bits (161), Expect = 3e-12 Identities = 41/127 (32%), Positives = 61/127 (48%), Gaps = 1/127 (0%) Frame = +3 Query: 9 KYTKLFINNEWVDAVSKKTFPTINPQDESVIVQVAEGXXXXXXXXXXXXXXXFHRYSEWR 188 K+ + I ++W DA +T +NP VI +V F S W Sbjct: 42 KHHQCLIGDQWCDAADGQTIQVLNPATAEVIARVPRAGQREIDRAVMAARQAFDD-SPWS 100 Query: 189 LLDASQRGLLLFKLATLMERDAKYLAELETLDNGKPVKQAEQ-EVLWASGIVRYYAGKAD 365 + +R LL+ A L+E++A LAE+E++DNGK AE ++ A +RY AG A Sbjct: 101 RIKPVERQKLLWNFADLIEKNAALLAEIESIDNGKSAVIAEHVDIRLAVDFLRYMAGFAT 160 Query: 366 KILGNTI 386 KI G T+ Sbjct: 161 KIEGRTV 167 Score = 56.8 bits (131), Expect = 1e-08 Identities = 22/39 (56%), Positives = 28/39 (71%) Frame = +2 Query: 434 VCGQILPWNYPIPMFIWNIAPALAAGCTVVVKPAEQTPL 550 V G I+ WN+P+ + W + PALA GCT V+KPAE TPL Sbjct: 190 VVGAIVAWNFPLLLACWKLGPALATGCTTVLKPAEDTPL 228 >SB_37963| Best HMM Match : Aldedh (HMM E-Value=1.8e-16) Length = 266 Score = 53.6 bits (123), Expect = 1e-07 Identities = 23/46 (50%), Positives = 31/46 (67%) Frame = +2 Query: 407 NIYLKGTRRVCGQILPWNYPIPMFIWNIAPALAAGCTVVVKPAEQT 544 N L+ + V G I PWN P+ + + IAPA+A+GCTVV KP+E T Sbjct: 140 NYSLRSPKGVAGLISPWNLPLYLLSFKIAPAVASGCTVVCKPSEMT 185 Score = 27.5 bits (58), Expect = 7.7 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 Query: 174 YSEWRLLDASQRGLLLFKLATLMERDAKYLAELETLDNGKPVKQA 308 + W + + R L KLA L+E + A+ E+ D GK V A Sbjct: 59 FKSWSVSSPAYRAERLRKLADLIEDRLEEFAQAESRDQGKTVNFA 103 >SB_12802| Best HMM Match : Aldedh (HMM E-Value=0) Length = 880 Score = 52.8 bits (121), Expect = 2e-07 Identities = 25/86 (29%), Positives = 46/86 (53%) Frame = +3 Query: 174 YSEWRLLDASQRGLLLFKLATLMERDAKYLAELETLDNGKPVKQAEQEVLWASGIVRYYA 353 + W +L S+RG +L + L+ + + +A++E DNGKP +A +V + ++ YYA Sbjct: 326 FKTWSVLSGSERGRILGDASRLVRKRREDIAKVEVHDNGKPFHEALWDVDNVADVLEYYA 385 Query: 354 GKADKILGNTIPADGEVLTFTLKEPV 431 G A + G + +T +EP+ Sbjct: 386 GVAPTLSGQHVQLPNGSFAYTRREPL 411 Score = 48.8 bits (111), Expect = 3e-06 Identities = 26/53 (49%), Positives = 30/53 (56%), Gaps = 4/53 (7%) Frame = +2 Query: 404 PNIYLKGTRR----VCGQILPWNYPIPMFIWNIAPALAAGCTVVVKPAEQTPL 550 PN TRR V G I WNYPI W IAPA+A G T+V KP+ TP+ Sbjct: 399 PNGSFAYTRREPLGVVGGIGAWNYPIQTACWKIAPAIACGNTIVYKPSPLTPM 451 >SB_58786| Best HMM Match : Aldedh (HMM E-Value=0) Length = 421 Score = 52.4 bits (120), Expect = 2e-07 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = +2 Query: 434 VCGQILPWNYPIPMFIWNIAPALAAGCTVVVKPAEQTPL 550 VC I PWN+PI M + + A+A GCT++ +P+ QTPL Sbjct: 84 VCASITPWNFPIAMLVRKASSAIACGCTMIARPSGQTPL 122 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/80 (32%), Positives = 52/80 (65%), Gaps = 2/80 (2%) Frame = +3 Query: 198 ASQRGLLLFKLATLMERDAKYLAELETLDNGKPVKQAEQEVLWASGIVRYYAGKADKILG 377 A +R ++L K L+ + +A++ TL++GKP+ +A EVL+A+ + +++ +A ++ G Sbjct: 4 AKERSIILRKWYDLILENIDDIAKIITLESGKPLLEARGEVLYAANYIEFFSEEAKRVYG 63 Query: 378 NTIPAD--GEVLTFTLKEPV 431 + IP++ G+ + T KEPV Sbjct: 64 DIIPSNNPGQKVLIT-KEPV 82 >SB_32909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 51.2 bits (117), Expect = 5e-07 Identities = 21/39 (53%), Positives = 27/39 (69%) Frame = +2 Query: 434 VCGQILPWNYPIPMFIWNIAPALAAGCTVVVKPAEQTPL 550 V G I+PWN+P+ + W + PALA G TVV+KPA T L Sbjct: 770 VVGGIVPWNFPLMLLCWKVCPALAMGNTVVLKPATYTRL 808 Score = 31.9 bits (69), Expect = 0.36 Identities = 30/105 (28%), Positives = 45/105 (42%), Gaps = 1/105 (0%) Frame = +3 Query: 69 PTINPQDESVIVQVAEGXXXXXXXXXXXXXXXFHRYSEWRLLDASQRGLLLFKLATLME- 245 P +NP E VI QVA+G S W A R +++ LA +E Sbjct: 1166 PILNPSGE-VIAQVADGNRKDIREAVEAAHKAA---SGWGKRAAHNRAQIVYYLAENLEM 1221 Query: 246 RDAKYLAELETLDNGKPVKQAEQEVLWASGIVRYYAGKADKILGN 380 R A+ A + + G+ + + + EV + + YY ADK GN Sbjct: 1222 RRAEVAARISDM-TGQSLDECKAEVDASIQRLFYYGAYADKFGGN 1265 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 434 VCGQILPWNYPIPMFIWNIAPALAAGCTVVVKPAEQTPL 550 V G P + F+ +APA+ G TVV+ P+E+ P+ Sbjct: 1294 VIGIACPDECSLLAFVSLLAPAIIRGNTVVIVPSEKYPV 1332 >SB_57708| Best HMM Match : Aldedh (HMM E-Value=0) Length = 528 Score = 47.6 bits (108), Expect = 7e-06 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +2 Query: 455 WNYPIPMFIWNIAPALAAGCTVVVKPAEQTP 547 WN+P+ M A ALAAGCTV++KP+E+TP Sbjct: 149 WNFPLGMITRKAAAALAAGCTVIIKPSEETP 179 >SB_15907| Best HMM Match : Aldedh (HMM E-Value=3.2e-23) Length = 275 Score = 47.2 bits (107), Expect = 9e-06 Identities = 21/38 (55%), Positives = 23/38 (60%) Frame = +2 Query: 434 VCGQILPWNYPIPMFIWNIAPALAAGCTVVVKPAEQTP 547 V G I PWN+P W IAPALA G +V KPA Q P Sbjct: 144 VVGIITPWNFPTATGAWKIAPALAFGNAIVWKPANQVP 181 >SB_19772| Best HMM Match : Aldedh (HMM E-Value=5.9e-12) Length = 211 Score = 44.8 bits (101), Expect = 5e-05 Identities = 26/51 (50%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Frame = +3 Query: 270 LETLDNGKPVKQA-EQEVLWASGIVRYYAGKADKILGNTIP---ADGEVLT 410 LETLDNGKP + ++ + RYYAG ADKI G TIP DGE +T Sbjct: 33 LETLDNGKPYNDSFNVDLEFTIKCYRYYAGWADKIHGKTIPLGKVDGEQMT 83 >SB_52935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1333 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 18 KLFINNEWVDAVSKKTFPTINPQDESVIVQVA 113 +LFIN E+VD+ KTF TINP D +V+ QV+ Sbjct: 710 QLFINGEFVDSHHGKTFNTINPTDGTVLAQVS 741 >SB_26122| Best HMM Match : Aldedh (HMM E-Value=0) Length = 462 Score = 32.7 bits (71), Expect = 0.21 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 446 ILPWNYPIPMFIWNIAPALAAGCTVVVKPAEQTPL 550 I W+ +P + ++ PA+A+G VV+KP+ PL Sbjct: 158 ITSWSQALPSILRHLVPAMASGNCVVIKPSCLAPL 192 >SB_42352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 749 Score = 31.1 bits (67), Expect = 0.63 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 446 ILPWNYPIPMFIWNIAPALAAGCTVVVKPAE 538 I WNYP+ + + A+A G V+KP+E Sbjct: 79 ISAWNYPVQLIFLPLVGAIAGGNCAVLKPSE 109 >SB_47411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +2 Query: 167 PSLLRMASPGCFTKRPTALQTGH-PHGERRKIFSRTRNTGQRKTSEASRTRSLVG 328 PSL++ S TK+ T +T H E + F+R G R+ + ++T+ L G Sbjct: 303 PSLMQRPSKKTQTKKGTGDETEDCRHAETMRDFTREYGRGVRQANVRAKTKELTG 357 >SB_22798| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3255 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 192 LDASQRGLLLFKLATLMERDAKYLAELETLDNGKPVKQAEQEVL 323 LDA G++ F+LA E + ++E D G P ++ V+ Sbjct: 2253 LDAGVNGVVKFRLAEQTELGGNRVVKVEAYDQGSPSLSSQVSVI 2296 >SB_17577| Best HMM Match : fn3 (HMM E-Value=0) Length = 1690 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 529 LNHNCATCSQSWSNVPYEHRDWVI 458 +N + T SWS VPYEH + +I Sbjct: 880 VNTSSTTVELSWSAVPYEHVNGII 903 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,549,327 Number of Sequences: 59808 Number of extensions: 355478 Number of successful extensions: 1058 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -