BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_M02 (537 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 24 0.74 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 1.3 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 1.3 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 1.3 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 1.3 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 1.3 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 1.3 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 1.3 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 1.3 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 1.3 L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protei... 22 3.9 AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. 22 3.9 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 22 3.9 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 21 5.2 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 21 9.1 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 9.1 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 24.2 bits (50), Expect = 0.74 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 352 TRLWMRIWNLSQVLEPSPQGVLRVVMRRTLV 260 TRLW R L +VL P R +R LV Sbjct: 533 TRLWPRAAALGEVLWSEPTNTWREAEQRILV 563 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.3 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 517 GAPPRVXXXXXXXXKINLFGSCAYASAMVTSTSTPG 410 GAPPR N S S + STS PG Sbjct: 120 GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPG 155 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.3 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 517 GAPPRVXXXXXXXXKINLFGSCAYASAMVTSTSTPG 410 GAPPR N S S + STS PG Sbjct: 120 GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPG 155 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.4 bits (48), Expect = 1.3 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 517 GAPPRVXXXXXXXXKINLFGSCAYASAMVTSTSTPG 410 GAPPR N S S + STS PG Sbjct: 120 GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPG 155 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.3 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 517 GAPPRVXXXXXXXXKINLFGSCAYASAMVTSTSTPG 410 GAPPR N S S + STS PG Sbjct: 120 GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPG 155 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.4 bits (48), Expect = 1.3 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 517 GAPPRVXXXXXXXXKINLFGSCAYASAMVTSTSTPG 410 GAPPR N S S + STS PG Sbjct: 120 GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPG 155 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.4 bits (48), Expect = 1.3 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 517 GAPPRVXXXXXXXXKINLFGSCAYASAMVTSTSTPG 410 GAPPR N S S + STS PG Sbjct: 76 GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPG 111 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 1.3 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 517 GAPPRVXXXXXXXXKINLFGSCAYASAMVTSTSTPG 410 GAPPR N S S + STS PG Sbjct: 120 GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPG 155 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.4 bits (48), Expect = 1.3 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 517 GAPPRVXXXXXXXXKINLFGSCAYASAMVTSTSTPG 410 GAPPR N S S + STS PG Sbjct: 120 GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPG 155 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 1.3 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -3 Query: 517 GAPPRVXXXXXXXXKINLFGSCAYASAMVTSTSTPG 410 GAPPR N S S + STS PG Sbjct: 120 GAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPG 155 >L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protein protein. Length = 46 Score = 21.8 bits (44), Expect = 3.9 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 357 RSHACGCASGICPKSWN 307 R+H C ICPK+++ Sbjct: 2 RTHTLPCKCTICPKAFS 18 >AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. Length = 150 Score = 21.8 bits (44), Expect = 3.9 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +3 Query: 231 LRVKGPVRMPT 263 +RVK P+RMPT Sbjct: 1 MRVKHPLRMPT 11 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.8 bits (44), Expect = 3.9 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +3 Query: 231 LRVKGPVRMPT 263 +RVK P+RMPT Sbjct: 1 MRVKHPLRMPT 11 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 21.4 bits (43), Expect = 5.2 Identities = 5/20 (25%), Positives = 15/20 (75%) Frame = +3 Query: 102 KDIEKPQAEISPIHRIRITL 161 +++EK + ++S +H+ +T+ Sbjct: 92 REVEKAKRDLSSVHKTTLTI 111 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 20.6 bits (41), Expect = 9.1 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 134 TDPSYQDHADVTQCTL 181 TDP+ D TQC L Sbjct: 154 TDPNRAPDCDPTQCVL 169 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 454 CAYASAMVTSTSTPGSILIEVICFTIS 374 C ASA++ ST + +++CF S Sbjct: 6 CLLASALLISTHQTEAKTDKILCFFAS 32 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,719 Number of Sequences: 336 Number of extensions: 2860 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13097125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -