BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L24 (346 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 1.2 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 4.7 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 20 8.2 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 22.6 bits (46), Expect = 1.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 38 NDYFFYSFIYSINISKFDSCTDLYN 112 N F + FI +S F+SCT L N Sbjct: 390 NFMFSFGFILLRFLSVFESCTRLNN 414 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 20.6 bits (41), Expect = 4.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 82 TDINRIYETVEKII 41 T++ R Y+ VEKI+ Sbjct: 65 TNLKRFYKVVEKIL 78 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 19.8 bits (39), Expect = 8.2 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +3 Query: 15 LYLINSNKMIIFSTVSYILLISVNLIRAQTCTTPRNESGNCV 140 L I N +++ + L I + +A+ CTT NCV Sbjct: 218 LVFITINFVVLLGDLYVTLYIILTNNQAKYCTTLIGLIKNCV 259 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,951 Number of Sequences: 336 Number of extensions: 1739 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6770240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -