BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L24 (346 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47033| Best HMM Match : WAP (HMM E-Value=1.8e-38) 30 0.44 SB_28905| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_31205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_23554| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_4318| Best HMM Match : Ligase_CoA (HMM E-Value=0) 27 4.1 SB_7186| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_29957| Best HMM Match : Pro_racemase (HMM E-Value=0) 26 7.1 SB_21939| Best HMM Match : F-box (HMM E-Value=0.001) 26 7.1 SB_20795| Best HMM Match : Amelogenin (HMM E-Value=1) 26 9.4 SB_8595| Best HMM Match : zf-AD (HMM E-Value=2.7) 26 9.4 SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.4 >SB_47033| Best HMM Match : WAP (HMM E-Value=1.8e-38) Length = 667 Score = 30.3 bits (65), Expect = 0.44 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 222 SQCGYENNIPMVCCPISNACKTPDDKPGICVGLYNC 329 S C + IP +C P ++AC T DD C+G C Sbjct: 528 STCPVMSRIPYMCNPTTHACDTDDD----CIGGAKC 559 >SB_28905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 27.9 bits (59), Expect = 2.3 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 175 SEIKAEQLRIRNF*ETHNVV-MRIIYLWCAVPFQTLVRLQTINREFVSV 318 S+++A R R + TH ++ M +I+L+C PF + + E S+ Sbjct: 222 SQVQANTARYRKY--THTMIWMFVIFLFCYTPFMLTSAVASFGTETASI 268 >SB_31205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1528 Score = 27.5 bits (58), Expect = 3.1 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +3 Query: 261 CPISNACKTPDDKPGICVGLYNCE 332 C N C+ P +C G NCE Sbjct: 1436 CKCGNCCEMPQQIENVCCGKRNCE 1459 >SB_23554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 27.5 bits (58), Expect = 3.1 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -1 Query: 172 KFSK-GSQSYRDTQFPDSFLGVVQVCARIKFTDINRIYETVEKIIILLLFI 23 +FSK G + Q PD LG V + + INR+Y + ++ + F+ Sbjct: 234 EFSKNGQNTIEAVQNPDMELGSVNSLSAVDIMQINRLYNCPQARLLGVCFV 284 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 27.1 bits (57), Expect = 4.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 138 VSLYDCEPLLNLFRNKSRTAEDKKLLGDSQC 230 + L D P+L L+ +SRT L GDS C Sbjct: 1151 IKLQDDVPILGLYSPESRTHGRIALYGDSNC 1181 >SB_4318| Best HMM Match : Ligase_CoA (HMM E-Value=0) Length = 229 Score = 27.1 bits (57), Expect = 4.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 151 IVSLY*IYSEIKAEQLRIRNF*ETHNVVMRIIYLWCAVPFQ 273 I LY ++ ++ A Q+ I F ET + ++ W A PFQ Sbjct: 5 IKRLYDVFLKVDATQVEINPFGETPDGKGKLFRSWKAQPFQ 45 >SB_7186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 26.6 bits (56), Expect = 5.4 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 111 TPRNESGNCVSLYDCEPLLNLFRNKSRTAEDKKLLGDSQCGYEN 242 T G C SL E LL+L ++ ED+ + + C YEN Sbjct: 3 TSEISKGKCTSL-KAESLLSLPNSQECGIEDENKVDRATCSYEN 45 >SB_29957| Best HMM Match : Pro_racemase (HMM E-Value=0) Length = 576 Score = 26.2 bits (55), Expect = 7.1 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = +3 Query: 75 ISVNLIRAQTCTTPRNESGNCVSLYDCEPLLNLFRNKSRTAEDKKLLGDSQCGYENN 245 IS+N ++ + T SG + D + L+ F+N +T E + + D + +E N Sbjct: 20 ISINNAKSDSKNTSNKGSGKSYQIVDTQKLIKRFKNLLQTNEIRDV--DLKSCFEEN 74 >SB_21939| Best HMM Match : F-box (HMM E-Value=0.001) Length = 909 Score = 26.2 bits (55), Expect = 7.1 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = +3 Query: 60 SYILLISVNLIRAQTCTTPRNESGNCVSLYDCEPLLNLFRNKSRTAEDKKLLGDSQCGYE 239 +Y+ L + + IR T NES C S Y+ +P +N ++S +D LL E Sbjct: 737 AYMYLYTGSPIR--NAITVHNESLPCDSAYNYQPPVNEALSQSGQDQDLPLLDSIDGRVE 794 Query: 240 NNI 248 N++ Sbjct: 795 NSV 797 >SB_20795| Best HMM Match : Amelogenin (HMM E-Value=1) Length = 630 Score = 25.8 bits (54), Expect = 9.4 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = -1 Query: 175 NKFSKGSQSYRDTQFPDSFLGVVQVCARIKFTDINRIYETVEKIIILLLFIKYNS 11 N F+K SY+ + + V A + + + +Y TV + I IK NS Sbjct: 109 NPFTKPMPSYKSNRHDGTNSSTEIVGANMNLSSLTTVYPTVTRKIFTDQMIKQNS 163 >SB_8595| Best HMM Match : zf-AD (HMM E-Value=2.7) Length = 347 Score = 25.8 bits (54), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 237 ENNIPMVCCPISNACKTPDDKPGICVGLYNCEH 335 ++N V + N +PD +P +C+ L C H Sbjct: 21 DDNSSKVMWSLINIIGSPDKEPAVCLYLRICNH 53 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 25.8 bits (54), Expect = 9.4 Identities = 16/68 (23%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +3 Query: 96 AQTCTTPRNESGNCVSLYDCEPLLNLFRNKSRTAED-KKLLGDSQCGYENNIPMVCCPIS 272 +QTC + + NC++ Y C+P+ RN+ D GD + E + + + Sbjct: 1591 SQTCAS--DAKANCIADYSCKPVFITRRNEILDPRDCNDKTGDKKSQTEAELGSLLRELK 1648 Query: 273 NACKTPDD 296 T D+ Sbjct: 1649 KPQNTSDE 1656 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,426,875 Number of Sequences: 59808 Number of extensions: 192665 Number of successful extensions: 474 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 473 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 510674393 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -