BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L23 (357 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g53890.1 68416.m05953 40S ribosomal protein S21 (RPS21B) ribo... 79 1e-15 At5g27700.1 68418.m03322 40S ribosomal protein S21 (RPS21C) ribo... 77 3e-15 At2g12505.1 68415.m01352 hypothetical protein 31 0.17 At5g14350.1 68418.m01677 plastocyanin-like domain-containing pro... 30 0.39 At5g24740.1 68418.m02920 expressed protein 29 0.91 At3g18190.1 68416.m02314 chaperonin, putative similar to SWISS-P... 29 0.91 At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 29 1.2 At3g04890.1 68416.m00531 expressed protein 28 2.1 At1g68020.2 68414.m07771 glycosyl transferase family 20 protein ... 27 2.8 At1g68020.1 68414.m07770 glycosyl transferase family 20 protein ... 27 2.8 At3g63180.1 68416.m07097 expressed protein 27 4.9 At2g35960.1 68415.m04414 harpin-induced family protein / HIN1 fa... 27 4.9 At2g35110.1 68415.m04307 HEM protein-related weak similarity to ... 27 4.9 At5g35450.1 68418.m04215 disease resistance protein (CC-NBS-LRR ... 26 8.5 At5g25520.2 68418.m03037 transcription elongation factor-related... 26 8.5 At5g25520.1 68418.m03036 transcription elongation factor-related... 26 8.5 At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / E... 26 8.5 At3g18390.1 68416.m02339 expressed protein contains Pfam domain,... 26 8.5 At1g31850.3 68414.m03915 dehydration-responsive protein, putativ... 26 8.5 At1g31850.2 68414.m03914 dehydration-responsive protein, putativ... 26 8.5 At1g31850.1 68414.m03913 dehydration-responsive protein, putativ... 26 8.5 At1g27180.1 68414.m03311 disease resistance protein (TIR-NBS-LRR... 26 8.5 At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR... 26 8.5 >At3g53890.1 68416.m05953 40S ribosomal protein S21 (RPS21B) ribosomal protein S21, cytosolic - Oryza sativa, PIR:S38357 Length = 82 Score = 78.6 bits (185), Expect = 1e-15 Identities = 38/81 (46%), Positives = 53/81 (65%) Frame = +3 Query: 21 MQNDAGEFVDLYCPRKCSASNRLIHAKDHASVQLVIADVDPATGRAADSSKMYVVCGAIR 200 M+NDAG+ +LY PRKCSA+NR+I +KDHASVQL I +D A G + +CG +R Sbjct: 1 MENDAGQVTELYIPRKCSATNRMITSKDHASVQLNIGHLD-ANGLYTGQFTTFALCGFVR 59 Query: 201 RMGESDDCIVRLTKKDGILAK 263 G++D + RL +K + AK Sbjct: 60 AQGDADSGVDRLWQKKKVEAK 80 >At5g27700.1 68418.m03322 40S ribosomal protein S21 (RPS21C) ribosomal protein S21, Zea mays, PIR:T03945 Length = 85 Score = 77.0 bits (181), Expect = 3e-15 Identities = 38/81 (46%), Positives = 52/81 (64%) Frame = +3 Query: 21 MQNDAGEFVDLYCPRKCSASNRLIHAKDHASVQLVIADVDPATGRAADSSKMYVVCGAIR 200 MQN+ G+ +LY PRKCSA+NRLI +KDHASVQL I +D A G + +CG +R Sbjct: 1 MQNEEGQVTELYIPRKCSATNRLITSKDHASVQLNIGHLD-ANGLYTGQFTTFALCGFVR 59 Query: 201 RMGESDDCIVRLTKKDGILAK 263 G++D + RL +K + AK Sbjct: 60 AQGDADSGVDRLWQKKKVEAK 80 >At2g12505.1 68415.m01352 hypothetical protein Length = 344 Score = 31.5 bits (68), Expect = 0.17 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = -2 Query: 275 TSVVLSQYPVFLSEPDYAVVGLSHPAN---GSTDHVHL 171 T + LS + LS+P Y +GLSHP G +D +HL Sbjct: 143 TFLDLSHPTIVLSDPFYQTIGLSHPTRPTIGLSDPIHL 180 >At5g14350.1 68418.m01677 plastocyanin-like domain-containing protein similar to NtEPc [Nicotiana tabacum] GI:4514716; contains Pfam profile PF02298: Plastocyanin-like domain Length = 490 Score = 30.3 bits (65), Expect = 0.39 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -2 Query: 248 VFLSEPDYAVVGLSHPANGSTDHVHLG-GVSSTSGCRVHVRYHELH 114 +FL EP+ +++G S +T+H+ LG VS+ V V ++E H Sbjct: 24 LFLCEPNRSLLGSSVGVGWNTEHLELGKEVSTEDSSSVSVDHYESH 69 >At5g24740.1 68418.m02920 expressed protein Length = 3306 Score = 29.1 bits (62), Expect = 0.91 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 168 RSQQHVRLQGPRPLSRAAPMR 106 RSQ+H RL+ PRPLSR P+R Sbjct: 3114 RSQRH-RLRLPRPLSREQPLR 3133 >At3g18190.1 68416.m02314 chaperonin, putative similar to SWISS-PROT:P50991- T-complex protein 1, delta subunit (TCP-1-delta) [Homo sapiens]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 536 Score = 29.1 bits (62), Expect = 0.91 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 187 QTTYILEESAARPVAGSTSAITSCTD 110 Q T ILEE+ +P+ STSAIT T+ Sbjct: 496 QITNILEENVVQPLLVSTSAITLATE 521 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 28.7 bits (61), Expect = 1.2 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = +3 Query: 123 VIADVDPATGRAADSSKMYVVCGA-----IRRMGESDDCIVRLTKKD 248 VI+++D A ADSS V C A + ++ +SD CI + + D Sbjct: 339 VISEIDAAIANGADSSPQLVACKAEAFLRLHQIKDSDLCISSIPRLD 385 >At3g04890.1 68416.m00531 expressed protein Length = 216 Score = 27.9 bits (59), Expect = 2.1 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +3 Query: 75 ASNRLIHAKDHASVQLVIADVDPATG-RAADSSKMYVVCGAIRRMGESDDCI 227 +S + KD + ++ DVD G +D Y V G + SDDCI Sbjct: 57 SSTSIATNKDRSKNEVTAGDVDDVMGILRSDYRNFYFVTGVLTSAIYSDDCI 108 >At1g68020.2 68414.m07771 glycosyl transferase family 20 protein / trehalose-phosphatase family protein similar to SP|Q00764 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit (EC 2.4.1.15) (Trehalose-6-phosphate synthase) {Saccharomyces cerevisiae}; contains Pfam profile: PF02358 trehalose-phosphatase Length = 860 Score = 27.5 bits (58), Expect = 2.8 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -3 Query: 145 AGSTSAITSCTDAWSFAW 92 +GS+S+ T C+ W+F+W Sbjct: 75 SGSSSSSTCCSKGWNFSW 92 >At1g68020.1 68414.m07770 glycosyl transferase family 20 protein / trehalose-phosphatase family protein similar to SP|Q00764 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit (EC 2.4.1.15) (Trehalose-6-phosphate synthase) {Saccharomyces cerevisiae}; contains Pfam profile: PF02358 trehalose-phosphatase Length = 700 Score = 27.5 bits (58), Expect = 2.8 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -3 Query: 145 AGSTSAITSCTDAWSFAW 92 +GS+S+ T C+ W+F+W Sbjct: 75 SGSSSSSTCCSKGWNFSW 92 >At3g63180.1 68416.m07097 expressed protein Length = 978 Score = 26.6 bits (56), Expect = 4.9 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -1 Query: 213 TLPSCEWLHRPRTSWRSQQHVRLQGPRPLSRAAPMR-GPSHGSDDYSPSISLGSTSQRIH 37 +L SC L+ + ++SQQ +R G +S AAP PS G S S T H Sbjct: 860 SLTSCTSLNLKQ--FQSQQQIRTHGQTQISFAAPTNPQPSQGKQGRSGGSSPSVTGSASH 917 >At2g35960.1 68415.m04414 harpin-induced family protein / HIN1 family protein / harpin-responsive family protein similar to harpin-induced protein hin1 ( GI:1619321) [Nicotiana tabacum] Length = 210 Score = 26.6 bits (56), Expect = 4.9 Identities = 21/70 (30%), Positives = 29/70 (41%) Frame = -2 Query: 212 LSHPANGSTDHVHLGGVSSTSGCRVHVRYHELHRCVVLRMDQTITRRAFPWAVQVNEFTS 33 LS P N T + + S R+ + Y LH R Q R A P Q ++ + Sbjct: 62 LSQP-NLLTSNFQITIASRNRNSRIGIYYDRLHVYATYRNQQITLRTAIPPTYQGHKEDN 120 Query: 32 VVLHFVYLSS 3 V FVY +S Sbjct: 121 VWSPFVYGNS 130 >At2g35110.1 68415.m04307 HEM protein-related weak similarity to Membrane-associated protein Hem (Dhem-2) (Swiss-Prot:P55162) [Drosophila melanogaster]; weak similarity to Nck-associated protein 1 (NAP 1) (p125Nap1) (Membrane-associated protein HEM-2) (Swiss-Prot:P55161) [Rattus norvegicus] Length = 1339 Score = 26.6 bits (56), Expect = 4.9 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -1 Query: 189 HRPRTSWRS--QQHVRLQGPRPLSRAAPMRGPSHGSDDYSPSISLGSTSQR 43 H P T RS Q+ PLS A+P PS SPS+ +T QR Sbjct: 1193 HVPYTILRSIYTQYYSNTPSTPLSTASPYHSPSVSLIHASPSMKNSTTPQR 1243 >At5g35450.1 68418.m04215 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 901 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 170 GGVSSTSGCRVHVRYHELHRCVVLRMDQTI 81 G + S+ G +H+R+ LH+ VV + TI Sbjct: 583 GKLPSSIGGLIHLRFLSLHQAVVSHLPSTI 612 >At5g25520.2 68418.m03037 transcription elongation factor-related contains weak similarity to transcription elongation factors Length = 997 Score = 25.8 bits (54), Expect = 8.5 Identities = 15/65 (23%), Positives = 29/65 (44%) Frame = +3 Query: 18 KMQNDAGEFVDLYCPRKCSASNRLIHAKDHASVQLVIADVDPATGRAADSSKMYVVCGAI 197 K ND E + +A+ L+H + + + ++ + A+ ADS++ CG Sbjct: 201 KTLNDGNESLRSKMKESLAAALALVHEHEESPKEKKNSETEEASVPVADSNEPASACGTS 260 Query: 198 RRMGE 212 +GE Sbjct: 261 VTVGE 265 >At5g25520.1 68418.m03036 transcription elongation factor-related contains weak similarity to transcription elongation factors Length = 735 Score = 25.8 bits (54), Expect = 8.5 Identities = 15/65 (23%), Positives = 29/65 (44%) Frame = +3 Query: 18 KMQNDAGEFVDLYCPRKCSASNRLIHAKDHASVQLVIADVDPATGRAADSSKMYVVCGAI 197 K ND E + +A+ L+H + + + ++ + A+ ADS++ CG Sbjct: 201 KTLNDGNESLRSKMKESLAAALALVHEHEESPKEKKNSETEEASVPVADSNEPASACGTS 260 Query: 198 RRMGE 212 +GE Sbjct: 261 VTVGE 265 >At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / EF-1-alpha, putative contains similarity to SWISS-PROT:Q9YAV0 elongation factor 1-alpha (EF-1-alpha) [Aeropyrum pernix] Length = 667 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 93 HAKDHASVQLVIADVDPATGRAADSS 170 HAK+ A+V ++A +DP TG+ S Sbjct: 587 HAKEAATVVKLVAMLDPKTGQPTKKS 612 >At3g18390.1 68416.m02339 expressed protein contains Pfam domain, PF04581: Protein of unknown function (DUF578) Length = 848 Score = 25.8 bits (54), Expect = 8.5 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 33 AGEFVDLYCPRKCSASNRLIHAKDHASVQLVIAD 134 AG L+ P SA + +AKD+ S LVI D Sbjct: 341 AGPKETLFVPDVSSAGDEATNAKDNQSAPLVIKD 374 >At1g31850.3 68414.m03915 dehydration-responsive protein, putative strong similarity to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 603 Score = 25.8 bits (54), Expect = 8.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 166 PPRCTWSVEPFAGWESP 216 PP+C S+EP + W +P Sbjct: 367 PPKCDDSIEPDSAWYTP 383 >At1g31850.2 68414.m03914 dehydration-responsive protein, putative strong similarity to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 603 Score = 25.8 bits (54), Expect = 8.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 166 PPRCTWSVEPFAGWESP 216 PP+C S+EP + W +P Sbjct: 367 PPKCDDSIEPDSAWYTP 383 >At1g31850.1 68414.m03913 dehydration-responsive protein, putative strong similarity to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 603 Score = 25.8 bits (54), Expect = 8.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 166 PPRCTWSVEPFAGWESP 216 PP+C S+EP + W +P Sbjct: 367 PPKCDDSIEPDSAWYTP 383 >At1g27180.1 68414.m03311 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1556 Score = 25.8 bits (54), Expect = 8.5 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 188 TDHVHLGGVSSTSGCRVHV-RYHELHRCVVLRMD 90 T+ +HL GV T+ ++H+ RY H V + D Sbjct: 1450 TNTLHLSGVPRTNNDQLHICRYSAFHPLVTMLKD 1483 >At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1544 Score = 25.8 bits (54), Expect = 8.5 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 188 TDHVHLGGVSSTSGCRVHV-RYHELHRCVVLRMD 90 T+ +HL GV T+ ++H+ RY H V + D Sbjct: 1436 TNTLHLSGVPRTNNDQLHICRYSAFHPLVTMLKD 1469 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,011,285 Number of Sequences: 28952 Number of extensions: 134080 Number of successful extensions: 504 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 459356736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -