BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L17 (639 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1389 + 26212117-26212119,26212721-26212875,26213402-262134... 35 0.047 04_04_1237 - 31991817-31992569,31993452-31993550,31994343-319949... 34 0.11 01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668,298... 34 0.11 07_03_0234 + 15561003-15561482,15562495-15562590,15562663-15562758 32 0.44 05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-98... 31 0.58 11_01_0115 - 889159-889921,889962-890053,890141-890359,890738-89... 31 0.77 12_01_0125 - 946480-947242,947283-947374,947462-947680,948059-94... 31 1.0 11_02_0060 + 7897868-7898296 30 1.3 03_01_0176 - 1416316-1416405,1416705-1416761,1416885-1417010,141... 30 1.3 02_01_0782 + 5827364-5827441,5827733-5827787,5828761-5828849,582... 30 1.3 05_01_0177 + 1231679-1231753,1232259-1232546,1232608-1232685,123... 30 1.8 01_01_1142 - 9057212-9057541,9058650-9058754,9058826-9058919,905... 30 1.8 03_06_0562 + 34732027-34733121 29 3.1 03_02_0472 - 8737955-8738580,8738704-8738767,8739090-8739239,873... 29 3.1 08_01_0611 - 5372966-5372992,5373965-5374024,5374260-5374365,537... 29 4.1 04_04_0095 - 22775340-22776017 29 4.1 03_02_0609 - 9823120-9823573,9823903-9824102,9824240-9824335,982... 29 4.1 02_01_0084 - 573638-574305,574705-574900,574997-577246,578053-57... 29 4.1 06_01_0749 + 5599238-5600128 28 5.4 05_07_0084 - 27587307-27589175 28 5.4 02_04_0169 + 20554715-20555083,20555150-20555632,20557926-205580... 28 5.4 11_01_0061 - 456521-457389,457534-457659,458377-459307,459564-45... 28 7.2 09_02_0470 + 9629062-9629355,9629948-9630893,9630948-9631102,963... 28 7.2 01_04_0036 - 15328741-15329868 28 7.2 10_01_0115 - 1426573-1426590,1426838-1426912,1427106-1427464,142... 27 9.5 09_03_0187 - 13253787-13254509 27 9.5 07_01_0640 + 4788530-4788645,4788665-4788830,4788913-4789224 27 9.5 02_05_0655 + 30668706-30668849,30669043-30669471 27 9.5 01_06_0390 - 28938485-28938751,28939924-28941282 27 9.5 >07_03_1389 + 26212117-26212119,26212721-26212875,26213402-26213479, 26214211-26214375,26214453-26214554,26214661-26214786, 26215454-26215490 Length = 221 Score = 35.1 bits (77), Expect = 0.047 Identities = 21/69 (30%), Positives = 32/69 (46%) Frame = +2 Query: 329 IYNSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCR 508 ++ + ++ SE + +SG R R + S P SP G SP+RS SY R Sbjct: 115 VFAEENRKKPSEMRSRDRISGSRGRSYDQRYSRSPRYSPPPRGRSPYRSP------SYSR 168 Query: 509 APQSRVSLR 535 +P R + R Sbjct: 169 SPSPRYARR 177 >04_04_1237 - 31991817-31992569,31993452-31993550,31994343-31994976, 31995329-31995585 Length = 580 Score = 33.9 bits (74), Expect = 0.11 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = -3 Query: 583 DTRRASRTLAGAVGNPTE*HSGLRRAAVRQRAHSRRAAMRTQPDGARRQR 434 +TRR R VG + H G+ AA RA RR +R G RR+R Sbjct: 361 ETRRCRRVAVVEVGEQQQGHQGVAAAAAVVRAVGRRLVVRRGGGGRRRRR 410 >01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668, 2986798-2986893,2987003-2987042,2987760-2987887 Length = 305 Score = 33.9 bits (74), Expect = 0.11 Identities = 36/100 (36%), Positives = 45/100 (45%), Gaps = 7/100 (7%) Frame = +2 Query: 320 DWDIYNSQRSRRTSES-AEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSL 496 DW +R R S S + + G S GR S SRS + SPR + RS S Sbjct: 128 DWKNRCYRRGRSYSRSPSPRRGRSRGRSYSRSRSRSYSRSQSPRRDSRNERRSRSPRDSR 187 Query: 497 SYCRAPQSRVSLRGVP-DSPS-KGS----ASPSGVAREEK 598 S +P+ S RG P DS S KGS SP G R+ + Sbjct: 188 SPRGSPRDSRSPRGSPRDSRSPKGSPRDTQSPRGSPRDSR 227 >07_03_0234 + 15561003-15561482,15562495-15562590,15562663-15562758 Length = 223 Score = 31.9 bits (69), Expect = 0.44 Identities = 26/64 (40%), Positives = 30/64 (46%) Frame = +2 Query: 395 RVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVSLRGVPDSPSKGSASP 574 R R S S +P A GLS S+P S S AP+SR S R SP G+ASP Sbjct: 40 RARAGPSSPSSSSPSTPTAAGLS-FLSSPGS-SASPNPAPRSRSSRRSPLASPRTGTASP 97 Query: 575 SGVA 586 A Sbjct: 98 LSAA 101 >05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-986919, 987020-987059,987751-987857 Length = 323 Score = 31.5 bits (68), Expect = 0.58 Identities = 27/81 (33%), Positives = 34/81 (41%) Frame = +2 Query: 338 SQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQ 517 S RR + S R R S SRS + SPRA R RSLSY R+P+ Sbjct: 155 SPSPRRGRGRSRSYSRSRSRSRSYSRSRSRSLSGSPRA-----RRELERSRSLSYSRSPR 209 Query: 518 SRVSLRGVPDSPSKGSASPSG 580 +S + K S +P G Sbjct: 210 RSISPAA---NEKKRSPTPDG 227 >11_01_0115 - 889159-889921,889962-890053,890141-890359,890738-891835 Length = 723 Score = 31.1 bits (67), Expect = 0.77 Identities = 23/83 (27%), Positives = 40/83 (48%) Frame = +2 Query: 350 RRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVS 529 + SE+A +S + R S + S+ SP G + S+P+++ S +P R + Sbjct: 174 KSVSEAAPPPAVSAAKRRFSSPAPSKQRDPSPSVKGGASRPSSPSVKGASRASSPAVRGT 233 Query: 530 LRGVPDSPSKGSASPSGVAREEK 598 R +PSK PS V+ +E+ Sbjct: 234 PRATSPAPSK-CVVPSLVSAKEE 255 >12_01_0125 - 946480-947242,947283-947374,947462-947680,948059-949156 Length = 723 Score = 30.7 bits (66), Expect = 1.0 Identities = 23/83 (27%), Positives = 39/83 (46%) Frame = +2 Query: 350 RRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVS 529 + E+A +S + R S + S+ SP G + S+P+++ S +P R + Sbjct: 174 KNVPEAAPPPAVSAAKRRFSSPAPSKQRDPSPSVKGGASRPSSPSVKGASRASSPAVRGT 233 Query: 530 LRGVPDSPSKGSASPSGVAREEK 598 R +PSK PS VA +E+ Sbjct: 234 PRATSPAPSK-CVVPSLVAAKEE 255 >11_02_0060 + 7897868-7898296 Length = 142 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -3 Query: 559 LAGAVGNPTE*HSGLRRAAVRQRAHSRRAAMRTQPDGARRQRW 431 LA P+ S L AA R R + AA R +PD A ++RW Sbjct: 9 LASCFRPPSSSSSSLSAAAAR-RGRRQEAAARRRPDKAEKRRW 50 >03_01_0176 - 1416316-1416405,1416705-1416761,1416885-1417010, 1417944-1418150,1418235-1418714 Length = 319 Score = 30.3 bits (65), Expect = 1.3 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = +2 Query: 422 SEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVSLRGVPDSPSKGSASPSGVAR 589 + P LSP AV + HRS PA+ L++ P R++ VP + G P AR Sbjct: 9 ARAPLLSPAAVAAA-HRSPPALLRLAFAPLPARRLA---VPLRVAVGEPEPEEDAR 60 >02_01_0782 + 5827364-5827441,5827733-5827787,5828761-5828849, 5829167-5829191,5829645-5829683,5830316-5830433, 5830857-5831023,5831155-5831518,5831589-5831701, 5832185-5832310,5832436-5833339,5833694-5834036 Length = 806 Score = 30.3 bits (65), Expect = 1.3 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 1/95 (1%) Frame = +2 Query: 341 QRSRRTSESAEK-VGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQ 517 +RS S EK + +S R R S+S P L ++V +SP RS S R+P Sbjct: 453 ERSESRSPPREKSISMSPQR-RSARRSKSRSP-LREKSVSMSPRRSMSKSLPRSVSRSPV 510 Query: 518 SRVSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 +R S R + ++ + S + + + SR +E+ Sbjct: 511 ARRS-RSPVKARTRSISRSSARSLQRRSRSRSLER 544 >05_01_0177 + 1231679-1231753,1232259-1232546,1232608-1232685, 1233458-1233673,1233862-1233981,1234079-1234804 Length = 500 Score = 29.9 bits (64), Expect = 1.8 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 14/80 (17%) Frame = +2 Query: 401 RKVSESRSEGPTLSPRA-----VGLSPHRSAPAMRSLSYCRAPQ------SRVSLRGVPD 547 RK++ S P L+P A V + P P ++ + + P+ V++ VP+ Sbjct: 29 RKLAASNPNPPDLTPSASLEVNVSVPPPPPPPPVQQIEEVKVPEVEQEQSKHVTVEAVPE 88 Query: 548 S---PSKGSASPSGVAREEK 598 + P++ S+ P GV+REE+ Sbjct: 89 AVPVPAQTSSLPPGVSREEQ 108 >01_01_1142 - 9057212-9057541,9058650-9058754,9058826-9058919, 9059721-9059917 Length = 241 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -1 Query: 594 SSRATPDGLAEPLLGLSGTPRSDTLDCGARQYDSERIAGALR 469 S+ A+ D +AE + SD +DCG + R+AG LR Sbjct: 7 SASASGDPMAECPPAAAAAEGSDAMDCGGGGRSNARVAGVLR 48 >03_06_0562 + 34732027-34733121 Length = 364 Score = 29.1 bits (62), Expect = 3.1 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Frame = +2 Query: 374 KVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQS-RVSLRGVPDS 550 K +GG+++K S + L S P L+ C+ +S R S G P Sbjct: 111 KGSAAGGKLQKFSYKIKTALGAVVKPGWLMVEFSFPGSDHLALCKVYRSPRTSRYGAPSP 170 Query: 551 PSKGSASPSGVA 586 PS ++SPS A Sbjct: 171 PSSAASSPSRAA 182 >03_02_0472 - 8737955-8738580,8738704-8738767,8739090-8739239, 8739311-8739422,8739686-8739708 Length = 324 Score = 29.1 bits (62), Expect = 3.1 Identities = 30/100 (30%), Positives = 42/100 (42%), Gaps = 5/100 (5%) Frame = +2 Query: 314 KNDWDIYNSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRS---APA 484 + + Y+++ SRR S S+ + G R R S R +SP+ +P+ Sbjct: 196 RRSYSPYDTRGSRRRSYSSYR----GSRYRSRSPYRYRRERSCSYDHSVSPYYRRCYSPS 251 Query: 485 MRSLSYCRA--PQSRVSLRGVPDSPSKGSASPSGVAREEK 598 R SY R+ PQ S PDS GS SP E K Sbjct: 252 ARGRSYSRSVSPQRSYSHSCSPDSQRSGSYSPRKRYSERK 291 >08_01_0611 - 5372966-5372992,5373965-5374024,5374260-5374365, 5374481-5374626,5375654-5375733,5375962-5376064, 5376597-5376675,5376854-5377134,5377374-5377548, 5377645-5377679 Length = 363 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +2 Query: 410 SESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 +E S PR +G+S HR +R L C+ P ++ Sbjct: 138 AEINSRADEYWPRVMGISTHRKIGVVRELRECKKPTAQ 175 >04_04_0095 - 22775340-22776017 Length = 225 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +2 Query: 434 TLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVSLRGVPDSPSKGS 565 T +P + G + R +PA R LS C+AP+ V +R + + + G+ Sbjct: 139 TPAPASSGSTWLRLSPACRELSGCKAPKLLVEVRMIHAADNYGA 182 >03_02_0609 - 9823120-9823573,9823903-9824102,9824240-9824335, 9824454-9824567,9824711-9824774,9825206-9825312 Length = 344 Score = 28.7 bits (61), Expect = 4.1 Identities = 30/85 (35%), Positives = 37/85 (43%), Gaps = 3/85 (3%) Frame = +2 Query: 335 NSQRSRRTSESAEKVGL---SGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYC 505 N RSR S S G R R +S SRS ++SP A G + S RS Sbjct: 192 NLSRSRSRSLSGSPRGRRDRDDRRSRSLSYSRSPRRSISPAANGKERNPSPNGRRS---P 248 Query: 506 RAPQSRVSLRGVPDSPSKGSASPSG 580 R+PQ RVS D+ + SP G Sbjct: 249 RSPQDRVS-PPPKDNDERNGDSPWG 272 >02_01_0084 - 573638-574305,574705-574900,574997-577246,578053-579174, 579266-579370,579975-580028,580244-580344,580454-581423, 582030-582203,582341-582643,582719-582856,582993-583247, 584230-584370,585008-585289,585395-585540,585627-585690, 585723-585799,586285-586301,587728-587867,587972-588029, 588121-588218,588727-588776,589260-589743 Length = 2630 Score = 28.7 bits (61), Expect = 4.1 Identities = 30/87 (34%), Positives = 37/87 (42%), Gaps = 2/87 (2%) Frame = +2 Query: 380 GLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVSLRGVPDSPSK 559 G GG + + PT S R G +P SAP + A R LRG PD P+ Sbjct: 13 GRGGGSTARANAGTGY-PTRS-RTSG-NPQFSAPTNGANQRAMA-SLRSPLRGGPDMPTS 68 Query: 560 GSASP--SGVAREEKFHSRLVEKLKRA 634 SP SG ++E V LKRA Sbjct: 69 RRCSPRLSGTQQDEVAEVARVGMLKRA 95 >06_01_0749 + 5599238-5600128 Length = 296 Score = 28.3 bits (60), Expect = 5.4 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = +2 Query: 335 NSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHR-SAPAMRSLSYCRA 511 +S RS++ S S+ + R +R+ P+LSPR G +P R S R S A Sbjct: 27 SSPRSKKRSSSSRRAAAGDRR----PAARAPNPSLSPRGGGGAPSRKSERRRRPRSLAMA 82 Query: 512 PQSRVSLRGVP 544 S G P Sbjct: 83 VHGHASTSGGP 93 >05_07_0084 - 27587307-27589175 Length = 622 Score = 28.3 bits (60), Expect = 5.4 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = -1 Query: 534 RSDTLDCGARQYDSERIAGALRCGLSPTARGDSVGPSERDSDTFRTRPPLSPTFSADSEV 355 R T+DC A + + GALR + T S G + D + +T F D V Sbjct: 154 REGTMDCWAHAVEFDYSTGALRSLKTATDTWCSSGAFDADGNLIQT----GGYFEGDKAV 209 Query: 354 RR-DRCE 337 RR D C+ Sbjct: 210 RRLDACD 216 >02_04_0169 + 20554715-20555083,20555150-20555632,20557926-20558003, 20558141-20558143 Length = 310 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -2 Query: 455 RRREATALAPRNATLTLSAHDLRSAQPSPQTPKYVETAANCICP 324 R+RE +LA R A L L SA P P P + A + P Sbjct: 150 RKRERNSLAARCARLGLGGSSSSSAPPPPPPPAAADDTAAVMPP 193 >11_01_0061 - 456521-457389,457534-457659,458377-459307,459564-459581, 459924-460183,461834-461918,462587-462919,463053-463137, 463289-463374,463455-463556,463656-463795,464332-464658, 464778-465389,465502-465586,465587-465682,465762-466115, 466212-466322,466426-466509,467086-467164,467742-467899, 468034-468150,468240-468398,468475-468557,469098-469200, 470784-471080 Length = 1899 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 582 TPDGLAEPLLGLSGTPRSDTLD 517 +PDGLA+PLL S P + LD Sbjct: 817 SPDGLADPLLSSSAAPSNMGLD 838 >09_02_0470 + 9629062-9629355,9629948-9630893,9630948-9631102, 9631299-9631358,9633374-9633444,9633626-9633663, 9633824-9633876,9633970-9635235,9635632-9635672, 9636821-9636887 Length = 996 Score = 27.9 bits (59), Expect = 7.2 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -1 Query: 351 RDRCELYMSQSFLTTG-----IINAISAAATVTLEFERF*GNNVNCMTKNCSSITENST 190 RDR + MS S ++TG + + V L+F+ + +N+ C T N + +TE ++ Sbjct: 855 RDRYGVEMSCSSISTGGNGRGLPLNLKNKKIVVLQFQIYVHHNIRCSTDNANLVTEETS 913 >01_04_0036 - 15328741-15329868 Length = 375 Score = 27.9 bits (59), Expect = 7.2 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +2 Query: 470 RSAPAMRSLSYCRAPQSRVSLRGVPDSPSKGSASPSGVAREEKFH--SRLVEKLK 628 R A + + +C P V L+ VP+ + G+ P R K H +L EKLK Sbjct: 304 RDAVRLSWVVFCEPPPESVLLQPVPELLADGADKPLFAPRTFKQHVQRKLFEKLK 358 >10_01_0115 - 1426573-1426590,1426838-1426912,1427106-1427464, 1427551-1427656,1428091-1428207,1428319-1428420, 1428520-1428613,1428697-1428746,1429029-1429106, 1429189-1429455,1429573-1429672,1429757-1430039, 1430312-1430357 Length = 564 Score = 27.5 bits (58), Expect = 9.5 Identities = 20/55 (36%), Positives = 25/55 (45%) Frame = +2 Query: 401 RKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVSLRGVPDSPSKGS 565 RK+S +R E PTLSP L P P S C P ++ + SKGS Sbjct: 354 RKISRARIEHPTLSPVCEELPP-MMLPTPGSPYSCDVPMVEKAIDAI--CQSKGS 405 >09_03_0187 - 13253787-13254509 Length = 240 Score = 27.5 bits (58), Expect = 9.5 Identities = 22/72 (30%), Positives = 30/72 (41%) Frame = -1 Query: 594 SSRATPDGLAEPLLGLSGTPRSDTLDCGARQYDSERIAGALRCGLSPTARGDSVGPSERD 415 ++ A G P LG++G S+ G+ E IAGA C SP R S D Sbjct: 55 AAEARTTGSGAPKLGMAGFATSEFRVFGSGSRGGEGIAGA--C--SPHGRSTSTTRGGAD 110 Query: 414 SDTFRTRPPLSP 379 +R L+P Sbjct: 111 GGPLTSRTDLAP 122 >07_01_0640 + 4788530-4788645,4788665-4788830,4788913-4789224 Length = 197 Score = 27.5 bits (58), Expect = 9.5 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +2 Query: 461 SPHRSAPAMRSLSYCRAPQSRVSLRGVPD-SPSKGSASPSGVAREEKFH 604 +PHR + R++ P+ R+S R V SP KGS P G A E F+ Sbjct: 5 APHRHSILNRTI----VPR-RISARHVSAASPDKGSGGPQGAAVNEAFN 48 >02_05_0655 + 30668706-30668849,30669043-30669471 Length = 190 Score = 27.5 bits (58), Expect = 9.5 Identities = 18/64 (28%), Positives = 25/64 (39%) Frame = +2 Query: 374 KVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVSLRGVPDSP 553 K SG +R S P L A PH + P+ R + +S + L G P Sbjct: 51 KTSQSGSLLRLGLVSPCSAPPLPTAAAYTPPHTNTPSSRRRHHAPLVRSGLRLLGSSRHP 110 Query: 554 SKGS 565 +GS Sbjct: 111 RRGS 114 >01_06_0390 - 28938485-28938751,28939924-28941282 Length = 541 Score = 27.5 bits (58), Expect = 9.5 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -1 Query: 558 LLGLSGTPRSDTLDCGARQYDSERIAGALRCGLSP-TARGDSVGPS 424 ++G G + C AR+ DSER G ++P ARG+ GP+ Sbjct: 139 MVGADGRAKLADFGC-ARRTDSERPIGGTPAFMAPEVARGEEQGPA 183 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,031,783 Number of Sequences: 37544 Number of extensions: 323549 Number of successful extensions: 1297 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1293 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -