BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L17 (639 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-2069|AAF53100.1| 588|Drosophila melanogaster CG14928-P... 33 0.33 BT004500-1|AAO42664.1| 216|Drosophila melanogaster GH08123p pro... 33 0.43 BT003286-1|AAO25044.1| 350|Drosophila melanogaster GM10155p pro... 33 0.43 BT001750-1|AAN71505.1| 216|Drosophila melanogaster RH01580p pro... 33 0.43 BT001495-1|AAN71250.1| 350|Drosophila melanogaster LD30815p pro... 33 0.43 BT001417-1|AAN71172.1| 216|Drosophila melanogaster GH12433p pro... 33 0.43 AY113327-1|AAM29332.1| 350|Drosophila melanogaster AT29232p pro... 33 0.43 AY069302-1|AAL39447.1| 216|Drosophila melanogaster HL03687p pro... 33 0.43 AE014297-1724|AAX52949.1| 216|Drosophila melanogaster CG10851-P... 33 0.43 AE014297-1723|AAN13579.1| 216|Drosophila melanogaster CG10851-P... 33 0.43 AE014297-1720|AAF54968.1| 329|Drosophila melanogaster CG10851-P... 33 0.43 AE014297-1719|AAN13576.1| 346|Drosophila melanogaster CG10851-P... 33 0.43 AE014297-1718|AAN13575.1| 350|Drosophila melanogaster CG10851-P... 33 0.43 AE014297-1717|AAF54969.2| 350|Drosophila melanogaster CG10851-P... 33 0.43 AY070561-1|AAL48032.1| 538|Drosophila melanogaster LD37523p pro... 32 0.57 AE014297-149|AAF52095.1| 538|Drosophila melanogaster CG2503-PA ... 32 0.57 X58720-1|CAA41556.1| 350|Drosophila melanogaster SRp55 protein. 31 1.00 AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p pro... 31 1.3 AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-P... 31 1.3 AE014296-2932|AAS64974.1| 884|Drosophila melanogaster CG6292-PA... 30 3.0 AE014296-2931|AAF49325.1| 1097|Drosophila melanogaster CG6292-PB... 30 3.0 AE014134-318|AAF51323.1| 1023|Drosophila melanogaster CG15356-PA... 29 4.0 X62599-1|CAA44483.1| 376|Drosophila melanogaster 52-kD bracketi... 29 7.0 AY118927-1|AAM50787.1| 374|Drosophila melanogaster LD23870p pro... 29 7.0 AJ459409-1|CAD30680.1| 374|Drosophila melanogaster RNA-binding ... 29 7.0 AE014297-964|AAF54396.2| 374|Drosophila melanogaster CG16788-PA... 29 7.0 AE014297-2568|AAF55584.1| 950|Drosophila melanogaster CG7709-PA... 28 9.3 >AE014134-2069|AAF53100.1| 588|Drosophila melanogaster CG14928-PA protein. Length = 588 Score = 33.1 bits (72), Expect = 0.33 Identities = 19/44 (43%), Positives = 22/44 (50%) Frame = +2 Query: 461 SPHRSAPAMRSLSYCRAPQSRVSLRGVPDSPSKGSASPSGVARE 592 SP R + + S AP S G P S S GSAS SG+ RE Sbjct: 373 SPERLRRPLTTTSSTSAPASSPPAGGTPASSSTGSASKSGLLRE 416 >BT004500-1|AAO42664.1| 216|Drosophila melanogaster GH08123p protein. Length = 216 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 68 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 127 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 128 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 160 >BT003286-1|AAO25044.1| 350|Drosophila melanogaster GM10155p protein. Length = 350 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 202 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 261 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 262 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 294 >BT001750-1|AAN71505.1| 216|Drosophila melanogaster RH01580p protein. Length = 216 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 68 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 127 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 128 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 160 >BT001495-1|AAN71250.1| 350|Drosophila melanogaster LD30815p protein. Length = 350 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 202 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 261 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 262 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 294 >BT001417-1|AAN71172.1| 216|Drosophila melanogaster GH12433p protein. Length = 216 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 68 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 127 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 128 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 160 >AY113327-1|AAM29332.1| 350|Drosophila melanogaster AT29232p protein. Length = 350 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 202 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 261 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 262 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 294 >AY069302-1|AAL39447.1| 216|Drosophila melanogaster HL03687p protein. Length = 216 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 68 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 127 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 128 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 160 >AE014297-1724|AAX52949.1| 216|Drosophila melanogaster CG10851-PH, isoform H protein. Length = 216 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 68 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 127 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 128 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 160 >AE014297-1723|AAN13579.1| 216|Drosophila melanogaster CG10851-PG, isoform G protein. Length = 216 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 68 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 127 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 128 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 160 >AE014297-1720|AAF54968.1| 329|Drosophila melanogaster CG10851-PB, isoform B protein. Length = 329 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 207 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 266 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 267 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 299 >AE014297-1719|AAN13576.1| 346|Drosophila melanogaster CG10851-PE, isoform E protein. Length = 346 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 198 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 257 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 258 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 290 >AE014297-1718|AAN13575.1| 350|Drosophila melanogaster CG10851-PC, isoform C protein. Length = 350 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 202 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 261 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 262 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 294 >AE014297-1717|AAF54969.2| 350|Drosophila melanogaster CG10851-PA, isoform A protein. Length = 350 Score = 32.7 bits (71), Expect = 0.43 Identities = 27/93 (29%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 202 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 261 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 262 DVSKSKSKSHSRTRSRSPKRERDSRSRSRSVSK 294 >AY070561-1|AAL48032.1| 538|Drosophila melanogaster LD37523p protein. Length = 538 Score = 32.3 bits (70), Expect = 0.57 Identities = 34/90 (37%), Positives = 40/90 (44%), Gaps = 3/90 (3%) Frame = +2 Query: 335 NSQRSRRTSESAEKVGLSGGRVRKVSESRSE---GPTLSPRAVGLSPHRSAPAMRSLSYC 505 + RSR S + + SG R R VS SRS G R+ S RS RS S Sbjct: 457 SGSRSRTNSPAGSQK--SGSRSRSVSRSRSRSKSGSRSRSRSRSKSGSRSRSGSRSGSGS 514 Query: 506 RAPQSRVSLRGVPDSPSKGSASPSGVAREE 595 R+P R SPS GS S SG A +E Sbjct: 515 RSPS-----RSRSGSPS-GSGSSSGSASDE 538 >AE014297-149|AAF52095.1| 538|Drosophila melanogaster CG2503-PA protein. Length = 538 Score = 32.3 bits (70), Expect = 0.57 Identities = 34/90 (37%), Positives = 40/90 (44%), Gaps = 3/90 (3%) Frame = +2 Query: 335 NSQRSRRTSESAEKVGLSGGRVRKVSESRSE---GPTLSPRAVGLSPHRSAPAMRSLSYC 505 + RSR S + + SG R R VS SRS G R+ S RS RS S Sbjct: 457 SGSRSRTNSPAGSQK--SGSRSRSVSRSRSRSKSGSRSRSRSRSKSGSRSRSGSRSGSGS 514 Query: 506 RAPQSRVSLRGVPDSPSKGSASPSGVAREE 595 R+P R SPS GS S SG A +E Sbjct: 515 RSPS-----RSRSGSPS-GSGSSSGSASDE 538 >X58720-1|CAA41556.1| 350|Drosophila melanogaster SRp55 protein. Length = 350 Score = 31.5 bits (68), Expect = 1.00 Identities = 26/93 (27%), Positives = 40/93 (43%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ S SRS+ + S G S +S RS S R+ +SR Sbjct: 202 RSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSRSNKSR 261 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + +R V K Sbjct: 262 DVSKSKSKSHSRTRSRSPKRERDSRSRTRSVSK 294 >AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p protein. Length = 1272 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/79 (26%), Positives = 36/79 (45%) Frame = +2 Query: 335 NSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAP 514 +S SR T+++ E L GR+ K + S P ++P A L P M + P Sbjct: 642 SSSSSRATAKTFENKSLIMGRIFKHASSAKAAPVMAPSAALLPGPSVVPGMAKIK--ALP 699 Query: 515 QSRVSLRGVPDSPSKGSAS 571 +++ +L + D GS + Sbjct: 700 KNQANLDQIFDELRGGSGA 718 >AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-PA protein. Length = 3539 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/79 (26%), Positives = 36/79 (45%) Frame = +2 Query: 335 NSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAP 514 +S SR T+++ E L GR+ K + S P ++P A L P M + P Sbjct: 2909 SSSSSRATAKTFENKSLIMGRIFKHASSAKAAPVMAPSAALLPGPSVVPGMAKIK--ALP 2966 Query: 515 QSRVSLRGVPDSPSKGSAS 571 +++ +L + D GS + Sbjct: 2967 KNQANLDQIFDELRGGSGA 2985 >AE014296-2932|AAS64974.1| 884|Drosophila melanogaster CG6292-PA, isoform A protein. Length = 884 Score = 29.9 bits (64), Expect = 3.0 Identities = 26/87 (29%), Positives = 40/87 (45%) Frame = +2 Query: 347 SRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRV 526 S+R+S S+ GR + + P VG+ PH S M S S + PQ Sbjct: 225 SQRSSSSSSSSSQQPGRPSMPVDYHKSSRGMPPVGVGMPPHGS-HKMTSGSKPQQPQQ-- 281 Query: 527 SLRGVPDSPSKGSASPSGVAREEKFHS 607 + VP PS ++S SG++ ++K S Sbjct: 282 --QPVP-HPSASNSSASGMSSKDKSQS 305 >AE014296-2931|AAF49325.1| 1097|Drosophila melanogaster CG6292-PB, isoform B protein. Length = 1097 Score = 29.9 bits (64), Expect = 3.0 Identities = 26/87 (29%), Positives = 40/87 (45%) Frame = +2 Query: 347 SRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRV 526 S+R+S S+ GR + + P VG+ PH S M S S + PQ Sbjct: 438 SQRSSSSSSSSSQQPGRPSMPVDYHKSSRGMPPVGVGMPPHGS-HKMTSGSKPQQPQQ-- 494 Query: 527 SLRGVPDSPSKGSASPSGVAREEKFHS 607 + VP PS ++S SG++ ++K S Sbjct: 495 --QPVP-HPSASNSSASGMSSKDKSQS 518 >AE014134-318|AAF51323.1| 1023|Drosophila melanogaster CG15356-PA protein. Length = 1023 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 464 PHRSAPAMRSLSYCRAPQSRVSLRGVPDSPSKGSASPS 577 P +A MR+L+ P+S V + G SP+ ++SP+ Sbjct: 791 PASAASGMRALTLATKPKSNVLVIGASTSPASAASSPN 828 >X62599-1|CAA44483.1| 376|Drosophila melanogaster 52-kD bracketing protein protein. Length = 376 Score = 28.7 bits (61), Expect = 7.0 Identities = 25/93 (26%), Positives = 39/93 (41%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR +S + R R+ + SRS+ + S G S +S RS S + +SR Sbjct: 207 RSRSSSSRSRSRSRRRSRSRRSTHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSASNKSR 266 Query: 524 VSLRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 + S S+ + R+ + SR V K Sbjct: 267 DVSKSKSKSHSRTAPVSPKRERDSRSRSRSVSK 299 >AY118927-1|AAM50787.1| 374|Drosophila melanogaster LD23870p protein. Length = 374 Score = 28.7 bits (61), Expect = 7.0 Identities = 25/94 (26%), Positives = 39/94 (41%) Frame = +2 Query: 326 DIYNSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYC 505 D S+++RR A G + + + SRS T SPR V SP + A + Sbjct: 89 DSDRSEKNRRRGGGA--AGKDKDKDKPSARSRSRSRTRSPRRVSKSPRPGSKARKEPERD 146 Query: 506 RAPQSRVSLRGVPDSPSKGSASPSGVAREEKFHS 607 R +SR R + +A+ S + E+ S Sbjct: 147 RDRRSRSRDRARRAGSNDRAAADSNNVKRERSRS 180 >AJ459409-1|CAD30680.1| 374|Drosophila melanogaster RNA-binding protein S1 protein. Length = 374 Score = 28.7 bits (61), Expect = 7.0 Identities = 25/94 (26%), Positives = 39/94 (41%) Frame = +2 Query: 326 DIYNSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYC 505 D S+++RR A G + + + SRS T SPR V SP + A + Sbjct: 89 DSDRSEKNRRRGGGA--AGKDKDKDKPSARSRSRSRTRSPRRVSKSPRPGSKARKEPERD 146 Query: 506 RAPQSRVSLRGVPDSPSKGSASPSGVAREEKFHS 607 R +SR R + +A+ S + E+ S Sbjct: 147 RDRRSRSRDRARRAGSNDRAAADSNNVKRERSRS 180 >AE014297-964|AAF54396.2| 374|Drosophila melanogaster CG16788-PA protein. Length = 374 Score = 28.7 bits (61), Expect = 7.0 Identities = 25/94 (26%), Positives = 39/94 (41%) Frame = +2 Query: 326 DIYNSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYC 505 D S+++RR A G + + + SRS T SPR V SP + A + Sbjct: 89 DSDRSEKNRRRGGGA--AGKDKDKDKPSARSRSRSRTRSPRRVSKSPRPGSKARKEPERD 146 Query: 506 RAPQSRVSLRGVPDSPSKGSASPSGVAREEKFHS 607 R +SR R + +A+ S + E+ S Sbjct: 147 RDRRSRSRDRARRAGSNDRAAADSNNVKRERSRS 180 >AE014297-2568|AAF55584.1| 950|Drosophila melanogaster CG7709-PA protein. Length = 950 Score = 28.3 bits (60), Expect = 9.3 Identities = 25/65 (38%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = +2 Query: 386 SGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVSLRG-VPDSPSKG 562 SGG S P+ S + G P+ SAP S SY AP S +S G P +PS Sbjct: 738 SGGPYAAAPSSSYSAPSSSSSSGG--PYPSAP---SSSYS-APSSSLSSGGPYPSAPSSS 791 Query: 563 SASPS 577 A+PS Sbjct: 792 YAAPS 796 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,254,940 Number of Sequences: 53049 Number of extensions: 514017 Number of successful extensions: 1889 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1883 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2682985500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -