BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L17 (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 23 2.5 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 3.3 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 23 3.3 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 4.4 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 4.4 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 5.8 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 5.8 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 5.8 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 5.8 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 5.8 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 5.8 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 22 5.8 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 22 5.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 5.8 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 7.6 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 7.6 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 7.6 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 7.6 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 21 7.6 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 21 7.6 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 21 7.6 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 21 7.6 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 7.6 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 7.6 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 21 7.6 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 7.6 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 7.6 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 7.6 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 7.6 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 7.6 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 7.6 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 7.6 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 7.6 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 7.6 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 7.6 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 7.6 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 7.6 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.6 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 7.6 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 7.6 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 7.6 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 7.6 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 7.6 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 7.6 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 7.6 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 7.6 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 7.6 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 7.6 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 7.6 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 7.6 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 7.6 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 365 SAEKVGLSGGRVRK 406 S E+VGL GGRV++ Sbjct: 266 SGERVGLVGGRVKE 279 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 3.3 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +2 Query: 473 SAPAMRSLSYCRAPQSRVSLRGVPDSPSKGSASPSGVAREEKFH 604 S P +LS C++ R V P G SP+ V+ F+ Sbjct: 78 SNPIKTALSVCKSLIERQVYAVVVSHPLTGDLSPAAVSYTSGFY 121 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 292 GVYDAGSQERLGHIQFAAV 348 G+YD ++ RLG ++ AV Sbjct: 320 GIYDISNKRRLGLTEYQAV 338 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 411 DTFRTRPPLSPTFSA 367 + +R RPPL+P F + Sbjct: 172 NAYRLRPPLNPRFGS 186 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 411 DTFRTRPPLSPTFSA 367 + +R RPPL+P F + Sbjct: 172 NAYRLRPPLNPRFGS 186 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 157 NAYRLRPPLNPRF 169 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 157 NAYRLRPPLNPRF 169 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 157 NAYRLRPPLNPRF 169 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 157 NAYRLRPPLNPRF 169 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 157 NAYRLRPPLNPRF 169 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 157 NAYRLRPPLNPRF 169 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 169 NAYRLRPPLNPRF 181 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 169 NAYRLRPPLNPRF 181 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 397 NAYRLRPPLNPRF 409 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 162 NAYRFRPPLNPRF 174 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 162 NAYRFRPPLNPRF 174 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 162 NAYRFRPPLNPRF 174 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 168 NAYRFRPPLNPRF 180 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 168 NAYRFRPPLNPRF 180 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 168 NAYRFRPPLNPRF 180 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 168 NAYRFRPPLNPRF 180 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 168 NAYRFRPPLNPRF 180 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 160 NAYRFRPPLNPRF 172 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 165 NAYRFRPPLNPRF 177 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 166 NAYRFRPPLNPRF 178 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 161 NAYRFRPPLNPRF 173 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 163 NAYRFRPPLNPRF 175 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 163 NAYRFRPPLNPRF 175 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 163 NAYRFRPPLNPRF 175 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 163 NAYRFRPPLNPRF 175 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 172 NAYRFRPPLNPRF 184 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 174 NAYRFRPPLNPRF 186 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 164 NAYRFRPPLNPRF 176 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 383 NAYRFRPPLNPRF 395 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 389 NAYRFRPPLNPRF 401 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 380 NAYRFRPPLNPRF 392 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 389 NAYRFRPPLNPRF 401 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 391 NAYRFRPPLNPRF 403 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 402 NAYRFRPPLNPRF 414 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 409 NAYRFRPPLNPRF 421 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 379 NAYRFRPPLNPRF 391 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 390 NAYRFRPPLNPRF 402 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 390 NAYRFRPPLNPRF 402 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 379 NAYRFRPPLNPRF 391 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 391 NAYRFRPPLNPRF 403 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 397 NAYRFRPPLNPRF 409 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 397 NAYRFRPPLNPRF 409 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 383 NVYRFRPPLNPRF 395 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 408 NAYRFRPPLNPRF 420 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 411 DTFRTRPPLSPTF 373 + +R RPPL+P F Sbjct: 411 NAYRFRPPLNPRF 423 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,619 Number of Sequences: 438 Number of extensions: 2880 Number of successful extensions: 86 Number of sequences better than 10.0: 66 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -