SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0001_L17
         (639 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        23   2.5  
AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    23   3.3  
AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.    23   3.3  
DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex det...    22   4.4  
DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex det...    22   4.4  
DQ325130-1|ABD14144.1|  174|Apis mellifera complementary sex det...    22   5.8  
DQ325129-1|ABD14143.1|  174|Apis mellifera complementary sex det...    22   5.8  
DQ325128-1|ABD14142.1|  174|Apis mellifera complementary sex det...    22   5.8  
DQ325127-1|ABD14141.1|  174|Apis mellifera complementary sex det...    22   5.8  
DQ325126-1|ABD14140.1|  174|Apis mellifera complementary sex det...    22   5.8  
DQ325125-1|ABD14139.1|  174|Apis mellifera complementary sex det...    22   5.8  
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    22   5.8  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    22   5.8  
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    22   5.8  
DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex det...    21   7.6  
DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex det...    21   7.6  
DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex det...    21   7.6  
DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex det...    21   7.6  
DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex det...    21   7.6  
DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex det...    21   7.6  
DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex det...    21   7.6  
DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex det...    21   7.6  
DQ325107-1|ABD14121.1|  176|Apis mellifera complementary sex det...    21   7.6  
DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex det...    21   7.6  
DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex det...    21   7.6  
DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex det...    21   7.6  
DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex det...    21   7.6  
DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex det...    21   7.6  
DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex det...    21   7.6  
DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex det...    21   7.6  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    21   7.6  
DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex det...    21   7.6  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    21   7.6  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    21   7.6  
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    21   7.6  
AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex det...    21   7.6  
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    21   7.6  
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    21   7.6  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    21   7.6  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    21   7.6  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    21   7.6  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    21   7.6  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    21   7.6  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    21   7.6  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    21   7.6  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    21   7.6  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    21   7.6  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    21   7.6  
AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex det...    21   7.6  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    21   7.6  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    21   7.6  

>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 9/14 (64%), Positives = 12/14 (85%)
 Frame = +2

Query: 365 SAEKVGLSGGRVRK 406
           S E+VGL GGRV++
Sbjct: 266 SGERVGLVGGRVKE 279


>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 13/44 (29%), Positives = 19/44 (43%)
 Frame = +2

Query: 473 SAPAMRSLSYCRAPQSRVSLRGVPDSPSKGSASPSGVAREEKFH 604
           S P   +LS C++   R     V   P  G  SP+ V+    F+
Sbjct: 78  SNPIKTALSVCKSLIERQVYAVVVSHPLTGDLSPAAVSYTSGFY 121


>AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.
          Length = 355

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = +1

Query: 292 GVYDAGSQERLGHIQFAAV 348
           G+YD  ++ RLG  ++ AV
Sbjct: 320 GIYDISNKRRLGLTEYQAV 338


>DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -1

Query: 411 DTFRTRPPLSPTFSA 367
           + +R RPPL+P F +
Sbjct: 172 NAYRLRPPLNPRFGS 186


>DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -1

Query: 411 DTFRTRPPLSPTFSA 367
           + +R RPPL+P F +
Sbjct: 172 NAYRLRPPLNPRFGS 186


>DQ325130-1|ABD14144.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 157 NAYRLRPPLNPRF 169


>DQ325129-1|ABD14143.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 157 NAYRLRPPLNPRF 169


>DQ325128-1|ABD14142.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 157 NAYRLRPPLNPRF 169


>DQ325127-1|ABD14141.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 157 NAYRLRPPLNPRF 169


>DQ325126-1|ABD14140.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 157 NAYRLRPPLNPRF 169


>DQ325125-1|ABD14139.1|  174|Apis mellifera complementary sex
           determiner protein.
          Length = 174

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 157 NAYRLRPPLNPRF 169


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 169 NAYRLRPPLNPRF 181


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 169 NAYRLRPPLNPRF 181


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 397 NAYRLRPPLNPRF 409


>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 162 NAYRFRPPLNPRF 174


>DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 162 NAYRFRPPLNPRF 174


>DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 162 NAYRFRPPLNPRF 174


>DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 168 NAYRFRPPLNPRF 180


>DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 168 NAYRFRPPLNPRF 180


>DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 168 NAYRFRPPLNPRF 180


>DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 168 NAYRFRPPLNPRF 180


>DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 168 NAYRFRPPLNPRF 180


>DQ325107-1|ABD14121.1|  176|Apis mellifera complementary sex
           determiner protein.
          Length = 176

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 160 NAYRFRPPLNPRF 172


>DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 165 NAYRFRPPLNPRF 177


>DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 166 NAYRFRPPLNPRF 178


>DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex
           determiner protein.
          Length = 178

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 161 NAYRFRPPLNPRF 173


>DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 163 NAYRFRPPLNPRF 175


>DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 163 NAYRFRPPLNPRF 175


>DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 163 NAYRFRPPLNPRF 175


>DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 163 NAYRFRPPLNPRF 175


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 172 NAYRFRPPLNPRF 184


>DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex
           determiner protein.
          Length = 191

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 174 NAYRFRPPLNPRF 186


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 164 NAYRFRPPLNPRF 176


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 383 NAYRFRPPLNPRF 395


>AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 389 NAYRFRPPLNPRF 401


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 380 NAYRFRPPLNPRF 392


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 389 NAYRFRPPLNPRF 401


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 391 NAYRFRPPLNPRF 403


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 402 NAYRFRPPLNPRF 414


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 409 NAYRFRPPLNPRF 421


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 379 NAYRFRPPLNPRF 391


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 390 NAYRFRPPLNPRF 402


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 390 NAYRFRPPLNPRF 402


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 379 NAYRFRPPLNPRF 391


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 391 NAYRFRPPLNPRF 403


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 397 NAYRFRPPLNPRF 409


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 397 NAYRFRPPLNPRF 409


>AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 383 NVYRFRPPLNPRF 395


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 408 NAYRFRPPLNPRF 420


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 411 DTFRTRPPLSPTF 373
           + +R RPPL+P F
Sbjct: 411 NAYRFRPPLNPRF 423


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 156,619
Number of Sequences: 438
Number of extensions: 2880
Number of successful extensions: 86
Number of sequences better than 10.0: 66
Number of HSP's better than 10.0 without gapping: 86
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 86
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19193721
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -