BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L17 (639 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 31 0.65 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 31 0.65 At2g41550.1 68415.m05135 expressed protein 30 1.1 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 30 1.5 At4g31620.1 68417.m04492 transcriptional factor B3 family protei... 29 3.4 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 29 3.4 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 29 3.4 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 29 3.4 At5g45573.1 68418.m05598 hypothetical protein 28 4.5 At4g29440.1 68417.m04203 expressed protein contains Pfam profil... 28 4.5 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 28 4.5 At2g06020.1 68415.m00658 myb family transcription factor contain... 28 4.5 At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 ... 28 4.5 At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 ... 28 4.5 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 28 6.0 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 28 6.0 At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16)... 28 6.0 At3g50810.1 68416.m05564 integral membrane protein, putative con... 28 6.0 At5g01770.1 68418.m00096 transducin family protein / WD-40 repea... 27 7.9 At3g08850.1 68416.m01029 transducin family protein / WD-40 repea... 27 7.9 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 31.1 bits (67), Expect = 0.65 Identities = 31/87 (35%), Positives = 40/87 (45%) Frame = +2 Query: 335 NSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAP 514 +S RSR S + + S R R +S S S ++S S RS P R S P Sbjct: 20 SSSRSRSGSSPSRSISRSRSRSRSLSSSSSPSRSVS------SGSRSPPR-RGKSPA-GP 71 Query: 515 QSRVSLRGVPDSPSKGSASPSGVAREE 595 R R P PSKG++SPS A +E Sbjct: 72 ARRG--RSPPPPPSKGASSPSKKAVQE 96 Score = 28.7 bits (61), Expect = 3.4 Identities = 23/60 (38%), Positives = 28/60 (46%) Frame = +2 Query: 410 SESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVSLRGVPDSPSKGSASPSGVAR 589 S SRS + S + S RS RSLS +P VS G P +G SP+G AR Sbjct: 16 SSSRSSSRSRSGSSPSRSISRSRSRSRSLSSSSSPSRSVS-SGSRSPPRRGK-SPAGPAR 73 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 31.1 bits (67), Expect = 0.65 Identities = 31/87 (35%), Positives = 40/87 (45%) Frame = +2 Query: 335 NSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAP 514 +S RSR S + + S R R +S S S ++S S RS P R S P Sbjct: 20 SSSRSRSGSSPSRSISRSRSRSRSLSSSSSPSRSVS------SGSRSPPR-RGKSPA-GP 71 Query: 515 QSRVSLRGVPDSPSKGSASPSGVAREE 595 R R P PSKG++SPS A +E Sbjct: 72 ARRG--RSPPPPPSKGASSPSKKAVQE 96 Score = 28.7 bits (61), Expect = 3.4 Identities = 23/60 (38%), Positives = 28/60 (46%) Frame = +2 Query: 410 SESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVSLRGVPDSPSKGSASPSGVAR 589 S SRS + S + S RS RSLS +P VS G P +G SP+G AR Sbjct: 16 SSSRSSSRSRSGSSPSRSISRSRSRSRSLSSSSSPSRSVS-SGSRSPPRRGK-SPAGPAR 73 >At2g41550.1 68415.m05135 expressed protein Length = 475 Score = 30.3 bits (65), Expect = 1.1 Identities = 22/91 (24%), Positives = 39/91 (42%), Gaps = 1/91 (1%) Frame = +2 Query: 353 RTSESAEKVGLSGGRVRKVS-ESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSRVS 529 ++S + + + G +R + E+R + T L H+ +++ + P + S Sbjct: 216 KSSSAISRESIGGSTLRPLHLETREKANTTDEDGDILKDHQQNDSLQDIVTVSEPFTTES 275 Query: 530 LRGVPDSPSKGSASPSGVAREEKFHSRLVEK 622 L + D P KG P G R +K H V K Sbjct: 276 LLEMCDEPDKGRDIPCG-ERSKKSHPEAVVK 305 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 29.9 bits (64), Expect = 1.5 Identities = 27/67 (40%), Positives = 32/67 (47%), Gaps = 6/67 (8%) Frame = +2 Query: 332 YNSQRSRRTSESAEKV-----GLSGGRVRKVSESRSEGPTLSPRA-VGLSPHRSAPAMRS 493 Y S RSR S S + S GR R S SRS + SPR + SP RS RS Sbjct: 198 YESSRSRSRSPSRSRSRSRSRSRSRGRGRSHSRSRSLSRSKSPRKDLSKSPRRS--LSRS 255 Query: 494 LSYCRAP 514 +S R+P Sbjct: 256 ISKSRSP 262 >At4g31620.1 68417.m04492 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 492 Score = 28.7 bits (61), Expect = 3.4 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -1 Query: 381 PTFSADSEVRRDRCELYMSQSFLTTGIINAISAAATVTLEFERF*GNNVNCMTKNCS 211 P++ + S+ RR E YM+ ++ N + T TLEF R G M K CS Sbjct: 330 PSYVSSSKQRR---EFYMAHGWIRFCEANKLKTGETFTLEFVR--GEGTTPMLKFCS 381 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 28.7 bits (61), Expect = 3.4 Identities = 23/88 (26%), Positives = 32/88 (36%) Frame = +2 Query: 335 NSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAP 514 NS+R R+ + R+ SRS P R R +PA R+P Sbjct: 256 NSRRRSRSRSVRRSLSPRRRRIHSPFRSRSRSPIRRHRRPTHEGRRQSPAPSRRR--RSP 313 Query: 515 QSRVSLRGVPDSPSKGSASPSGVAREEK 598 R P P++ SPS AR + Sbjct: 314 SPPARRRRSPSPPARRRRSPSPPARRHR 341 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.7 bits (61), Expect = 3.4 Identities = 29/80 (36%), Positives = 32/80 (40%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR S S S R S SRS GP S RS RS S R+P Sbjct: 226 RSRSRSRSRSPKAKSSRRSPAKSTSRSPGPR--------SKSRSPSPRRSRSRSRSPLPS 277 Query: 524 VSLRGVPDSPSKGSASPSGV 583 V G SPSK S + S + Sbjct: 278 VQKEG-SKSPSKPSPAKSPI 296 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.7 bits (61), Expect = 3.4 Identities = 29/80 (36%), Positives = 32/80 (40%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 RSR S S S R S SRS GP S RS RS S R+P Sbjct: 226 RSRSRSRSRSPKAKSSRRSPAKSTSRSPGPR--------SKSRSPSPRRSRSRSRSPLPS 277 Query: 524 VSLRGVPDSPSKGSASPSGV 583 V G SPSK S + S + Sbjct: 278 VQKEG-SKSPSKPSPAKSPI 296 >At5g45573.1 68418.m05598 hypothetical protein Length = 195 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 533 RGVPDSPSKGSASPSGVAREEKFHSRLVEKL 625 RG+P S SA PS VAR+ +LV L Sbjct: 99 RGIPPVSSSSSARPSQVARQLALPKKLVSSL 129 >At4g29440.1 68417.m04203 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 1090 Score = 28.3 bits (60), Expect = 4.5 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +2 Query: 347 SRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSY 502 SRRT + L ++ KVS P LSP A L+ + + + SLSY Sbjct: 857 SRRTKGQERRPSLVTAKIDKVSFDEESPPKLSPEAKPLTKQQGSAS--SLSY 906 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 28.3 bits (60), Expect = 4.5 Identities = 29/94 (30%), Positives = 38/94 (40%), Gaps = 12/94 (12%) Frame = +2 Query: 317 NDWDIYNSQRSRRTSESAEKVGLSGGRVRKVSESRS-----EGPT------LSPRAVG-L 460 +D Y S + G SGGR R S SRS + PT SPRA Sbjct: 94 SDLKCYECGESGHFARECRSRGGSGGRRRSRSRSRSPPRYRKSPTYGGRRSYSPRARSPP 153 Query: 461 SPHRSAPAMRSLSYCRAPQSRVSLRGVPDSPSKG 562 P R +P+ R +Y R+P + VP + G Sbjct: 154 PPRRRSPSPRGRNYSRSPPPYRARDEVPYANGNG 187 >At2g06020.1 68415.m00658 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 301 Score = 28.3 bits (60), Expect = 4.5 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +2 Query: 308 VVKNDWDIYNSQRSRRTSESAEKVGLSGG 394 +++++ + YN + + T E+AEKVG+ G Sbjct: 40 ILQSNKETYNEKLEKNTKENAEKVGIEEG 68 >At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 28.3 bits (60), Expect = 4.5 Identities = 28/109 (25%), Positives = 43/109 (39%) Frame = +2 Query: 299 MMPVVKNDWDIYNSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSA 478 ++ + D + S R R E + + + KV + S+G L LS S Sbjct: 631 LLTAIDADGGLQASPRIRFNKEGSLLAVSANDNMIKVM-ANSDGLRLLHTVENLSSESSK 689 Query: 479 PAMRSLSYCRAPQSRVSLRGVPDSPSKGSASPSGVAREEKFHSRLVEKL 625 PA+ S+ P S VS+ G+ + S+ V EE V KL Sbjct: 690 PAINSIPMVERPASVVSIPGM-NGDSRNMVDVKPVITEESNDKSKVWKL 737 >At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 28.3 bits (60), Expect = 4.5 Identities = 28/109 (25%), Positives = 43/109 (39%) Frame = +2 Query: 299 MMPVVKNDWDIYNSQRSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSA 478 ++ + D + S R R E + + + KV + S+G L LS S Sbjct: 631 LLTAIDADGGLQASPRIRFNKEGSLLAVSANDNMIKVM-ANSDGLRLLHTVENLSSESSK 689 Query: 479 PAMRSLSYCRAPQSRVSLRGVPDSPSKGSASPSGVAREEKFHSRLVEKL 625 PA+ S+ P S VS+ G+ + S+ V EE V KL Sbjct: 690 PAINSIPMVERPASVVSIPGM-NGDSRNMVDVKPVITEESNDKSKVWKL 737 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 27.9 bits (59), Expect = 6.0 Identities = 28/85 (32%), Positives = 35/85 (41%), Gaps = 7/85 (8%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 R R S SA R R +ESRS +LS SP S+P S + +P R Sbjct: 181 RRRTRSRSASPDEKRRVRGRYDNESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKR 240 Query: 524 VSLRG-------VPDSPSKGSASPS 577 + R P SP+ ASPS Sbjct: 241 SNERSPSPRRSLSPRSPALQKASPS 265 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 27.9 bits (59), Expect = 6.0 Identities = 28/85 (32%), Positives = 35/85 (41%), Gaps = 7/85 (8%) Frame = +2 Query: 344 RSRRTSESAEKVGLSGGRVRKVSESRSEGPTLSPRAVGLSPHRSAPAMRSLSYCRAPQSR 523 R R S SA R R +ESRS +LS SP S+P S + +P R Sbjct: 181 RRRTRSRSASPDEKRRVRGRYDNESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKR 240 Query: 524 VSLRG-------VPDSPSKGSASPS 577 + R P SP+ ASPS Sbjct: 241 SNERSPSPRRSLSPRSPALQKASPS 265 >At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16) identical to cDNA DEAD box RNA helicase, RH16 GI:3776006 Length = 626 Score = 27.9 bits (59), Expect = 6.0 Identities = 20/67 (29%), Positives = 32/67 (47%) Frame = +2 Query: 239 LFP*KRSNSRVTVAAAEMAFMMPVVKNDWDIYNSQRSRRTSESAEKVGLSGGRVRKVSES 418 L P + NS V V E A + +ND + Q+ +S E++GL +R +++ Sbjct: 6 LKPVEDVNSEV-VDEVEKAEEVEEQRNDREQEEEQKEEEAPKSFEELGLDSRLIRALTKK 64 Query: 419 RSEGPTL 439 E PTL Sbjct: 65 GIEKPTL 71 >At3g50810.1 68416.m05564 integral membrane protein, putative contains 4 transmembrane domains; contains Pfam PF04535 : Domain of unknown function (DUF588); similar to putative ethylene responsive element binding protein (GI:22135858) [Arabidopsis thaliana] Length = 235 Score = 27.9 bits (59), Expect = 6.0 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -1 Query: 300 INAISAAATVTLE--FERF*GNNVNCMTKNCSSITENSTPIDNPCLK 166 I+A S+A ++E F G+ ++ + +N S +TE S ID P +K Sbjct: 174 IDAASSALFCSMECKFRSVLGSQLDELMENSSEVTEISEEIDEPVMK 220 >At5g01770.1 68418.m00096 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein mip1 (SP:P87141) [Schizosaccharomyces pombe] Length = 1354 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 1/19 (5%) Frame = -1 Query: 582 TPD-GLAEPLLGLSGTPRS 529 +PD GLA+P+LG+SG+ RS Sbjct: 933 SPDSGLADPILGVSGSERS 951 >At3g08850.1 68416.m01029 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein mip1 (SP:P87141) [Schizosaccharomyces pombe]; contains Pfam PF00400: WD domain, G-beta repeat (5 copies, 1 weak) Length = 1344 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 1/19 (5%) Frame = -1 Query: 582 TPD-GLAEPLLGLSGTPRS 529 +PD GLA+PLLG SG+ RS Sbjct: 941 SPDSGLADPLLGASGSERS 959 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,235,960 Number of Sequences: 28952 Number of extensions: 228818 Number of successful extensions: 795 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 791 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -