BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L14 (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38320.1 68415.m04708 expressed protein 29 3.0 At2g23600.1 68415.m02816 hydrolase, alpha/beta fold family prote... 29 3.0 At2g23590.1 68415.m02815 hydrolase, alpha/beta fold family prote... 29 3.9 At4g33380.1 68417.m04745 expressed protein 27 9.1 >At2g38320.1 68415.m04708 expressed protein Length = 410 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 352 MLDKTRKSKMDYVRQSVCNGPETFSVCCGPPPEINPEDMTLNERCSRAVTAFPLESN 522 +L++ R +M YV S+ G VC NP+ M ++ S +T LE N Sbjct: 120 LLERLRNKRMVYVGDSLNRGQWVSMVCMVSSVITNPKAMYMHNNGSNLITFKALEYN 176 >At2g23600.1 68415.m02816 hydrolase, alpha/beta fold family protein similar to ethylene-induced esterase [Citrus sinensis] GI:14279437, polyneuridine aldehyde esterase [Rauvolfia serpentina] GI:6651393; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 263 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 586 ITQYPWLVVIEYESFDHMKLLCGGSLISSKYVLTA 690 I YP +VIE E DHM + C L+S + A Sbjct: 225 IHNYPANLVIEMEETDHMPMFCKPQLLSDHLLAIA 259 >At2g23590.1 68415.m02815 hydrolase, alpha/beta fold family protein similar to ethylene-induced esterase [Citrus sinensis] GI:14279437, polyneuridine aldehyde esterase [Rauvolfia serpentina] GI:6651393; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 272 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 586 ITQYPWLVVIEYESFDHMKLLCGGSLISSKYVLTA 690 I YP +VIE E DH+ L C L+S + A Sbjct: 234 IDNYPPNLVIEMEGTDHLPLFCKPQLLSDHLLAIA 268 >At4g33380.1 68417.m04745 expressed protein Length = 328 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 642 AAMRW-LTHQFEVRAHCCTLC 701 AA+RW LTH E A CC C Sbjct: 229 AAVRWGLTHHKESAADCCQAC 249 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,277,124 Number of Sequences: 28952 Number of extensions: 321356 Number of successful extensions: 744 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -