BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L12 (192 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 1.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 1.0 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 1.8 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 1.8 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 1.8 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 21 1.8 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 1.8 AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor prot... 21 1.8 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 20 2.3 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 20 2.3 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 20 3.1 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 19 5.4 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 19 5.4 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 19 5.4 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 19 5.4 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 19 7.1 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 19 7.1 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 19 7.1 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 19 7.1 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 19 7.1 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 19 7.1 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 19 7.1 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 19 7.1 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 19 7.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 19 7.1 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 18 9.4 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 18 9.4 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 18 9.4 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 18 9.4 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 18 9.4 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 18 9.4 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 18 9.4 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 18 9.4 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 18 9.4 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 18 9.4 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 18 9.4 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 18 9.4 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 18 9.4 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 18 9.4 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 18 9.4 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 18 9.4 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 18 9.4 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 18 9.4 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 18 9.4 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 18 9.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 18 9.4 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 18 9.4 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 1.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 1 VRFTIKFTXMNPDETTSKEDNK 66 VRF + T M D T KED K Sbjct: 491 VRFIAEHTKMLEDSTKVKEDWK 512 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 1.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 1 VRFTIKFTXMNPDETTSKEDNK 66 VRF + T M D T KED K Sbjct: 491 VRFIAEHTKMLEDSTKVKEDWK 512 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 20.6 bits (41), Expect = 1.8 Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -1 Query: 93 IWIVKSPLFFIIF---FACGFVRVHXGKLNSEA 4 IW+ PLF II+ F V H + +A Sbjct: 222 IWVYFVPLFLIIYSYWFIIQAVAAHEKNMREQA 254 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.6 bits (41), Expect = 1.8 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELSSG 140 Q+ +KN YRE S G Sbjct: 269 QNSYKNEREYRKYRETSKG 287 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 1.8 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELSSG 140 Q+ +KN YRE S G Sbjct: 280 QNSYKNEREYRKYRETSKG 298 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 20.6 bits (41), Expect = 1.8 Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -1 Query: 93 IWIVKSPLFFIIF---FACGFVRVHXGKLNSEA 4 IW+ PLF II+ F V H + +A Sbjct: 98 IWVYFVPLFLIIYSYWFIIQAVAAHEKNMREQA 130 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 20.6 bits (41), Expect = 1.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 95 QECRTSKCL 121 QECR KCL Sbjct: 240 QECRLKKCL 248 >AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor protein. Length = 72 Score = 20.6 bits (41), Expect = 1.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 95 QECRTSKCL 121 QECR KCL Sbjct: 37 QECRLKKCL 45 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 20.2 bits (40), Expect = 2.3 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 Query: 93 IWIVKSPLFFIIFF 52 IW PL FII F Sbjct: 226 IWAYVIPLIFIILF 239 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 20.2 bits (40), Expect = 2.3 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 Query: 93 IWIVKSPLFFIIFF 52 IW PL FII F Sbjct: 226 IWAYVIPLIFIILF 239 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 19.8 bits (39), Expect = 3.1 Identities = 6/25 (24%), Positives = 12/25 (48%) Frame = -1 Query: 90 WIVKSPLFFIIFFACGFVRVHXGKL 16 W+ + +I G+V +H G + Sbjct: 51 WLSFIRIVLVILLRAGYVLIHIGSV 75 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 19.0 bits (37), Expect = 5.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 191 LLYRGSIPSLATIXFAISG 135 LLYR + P+LA I + G Sbjct: 43 LLYRVAQPALANITWYNEG 61 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 19.0 bits (37), Expect = 5.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 191 LLYRGSIPSLATIXFAISG 135 LLYR + P+LA I + G Sbjct: 43 LLYRVAQPALANITWYNEG 61 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 19.0 bits (37), Expect = 5.4 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -1 Query: 159 NNFXRNLRMRAPCKHFDVRHS*IWIVKSPLF 67 N F + + C +RH+ IW+ LF Sbjct: 205 NAFEYAMAVMKMCDILHLRHTKIWLRPDWLF 235 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 19.0 bits (37), Expect = 5.4 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +1 Query: 1 VRFTIKFTXMNPDETTSKEDNK 66 +RF T D T KED K Sbjct: 486 IRFIADHTKREEDSTRVKEDWK 507 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 18.6 bits (36), Expect = 7.1 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYQKYRETS 63 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 18.6 bits (36), Expect = 7.1 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYQKYRETS 63 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 18.6 bits (36), Expect = 7.1 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYQKYRETS 63 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 18.6 bits (36), Expect = 7.1 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYQKYRETS 63 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 18.6 bits (36), Expect = 7.1 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYQKYRETS 63 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 18.6 bits (36), Expect = 7.1 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYQKYRETS 63 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 18.6 bits (36), Expect = 7.1 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYQKYRETS 63 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 18.6 bits (36), Expect = 7.1 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN + YRE S Sbjct: 47 QNSYKNEKEYRKYRETS 63 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 18.6 bits (36), Expect = 7.1 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +2 Query: 62 IKNKGLLTIQIQECRTSKCLQGALIRRLRXKLLQGSE 172 IK+K + + CR C++G L++ +L+G+E Sbjct: 597 IKDKNK-KVNVAGCR---CVKGILLKSGLYHVLRGNE 629 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 18.6 bits (36), Expect = 7.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 107 TSKCLQGALIRRLRXKLLQGSE 172 TSK AL RR++ +L +E Sbjct: 456 TSKLFGRALSRRIKATVLFATE 477 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN + YRE S Sbjct: 47 QNSYKNEKEYRKYRERS 63 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN + YRE S Sbjct: 47 QNSYKNEKEYRKYRERS 63 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 46 QNSYKNEREYRKYRETS 62 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 46 QNSYKNEREYRKYRETS 62 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 47 QNSYKNEREYRKYRETS 63 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 84 QSKFKNAEHQSVYRELS 134 Q+ +KN YRE S Sbjct: 269 QNSYKNEREYRKYRETS 285 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 18.2 bits (35), Expect = 9.4 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -1 Query: 87 IVKSPLFFIIFFACGFVRVHXG 22 ++K+P+F F GF + G Sbjct: 98 MIKTPIFIYNSFNTGFALGNLG 119 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,049 Number of Sequences: 438 Number of extensions: 702 Number of successful extensions: 47 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 146,343 effective HSP length: 43 effective length of database: 127,509 effective search space used: 2550180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (18.9 bits)
- SilkBase 1999-2023 -