BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L06 (582 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 0.82 AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 21 5.8 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 5.8 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 5.8 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 24.2 bits (50), Expect = 0.82 Identities = 13/47 (27%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = +2 Query: 137 HSVHSVG-----GQTRWQACRARWSVAEWSATLHWTFCFQRVSPAQD 262 HS H G G+T RW E +W FC +R + + + Sbjct: 315 HSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDE 361 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 462 LVDEAVIKAIRLRPEQKTLRGYLRASFGLRSSQF 563 LVD+ +I + R YLR + G +S QF Sbjct: 45 LVDQVMILETMTPLDFMDFRCYLRPASGFQSLQF 78 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 462 LVDEAVIKAIRLRPEQKTLRGYLRASFGLRSSQF 563 LVD+ +I + R YLR + G +S QF Sbjct: 105 LVDQVMILETMTPLDFMDFRCYLRPASGFQSLQF 138 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 462 LVDEAVIKAIRLRPEQKTLRGYLRASFGLRSSQF 563 LVD+ +I + R YLR + G +S QF Sbjct: 105 LVDQVMILETMTPLDFMDFRCYLRPASGFQSLQF 138 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,237 Number of Sequences: 336 Number of extensions: 2443 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -