BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L05 (347 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52724| Best HMM Match : adh_short (HMM E-Value=5.1e-08) 29 1.0 SB_38059| Best HMM Match : Zfx_Zfy_act (HMM E-Value=2.6) 29 1.0 SB_31651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_44176| Best HMM Match : PAP_assoc (HMM E-Value=0.56) 28 2.4 SB_12097| Best HMM Match : Birna_VP5 (HMM E-Value=4.6) 28 2.4 SB_11502| Best HMM Match : PA (HMM E-Value=9.3) 28 2.4 SB_12922| Best HMM Match : MFS_1 (HMM E-Value=1.1) 27 4.2 SB_5822| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.5 SB_50861| Best HMM Match : Borrelia_orfA (HMM E-Value=4.4) 26 9.7 SB_23067| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.7 SB_12636| Best HMM Match : PI-PLC-Y (HMM E-Value=1.2e-18) 26 9.7 SB_51089| Best HMM Match : I-set (HMM E-Value=1.4e-38) 26 9.7 SB_21037| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.7 >SB_52724| Best HMM Match : adh_short (HMM E-Value=5.1e-08) Length = 316 Score = 29.1 bits (62), Expect = 1.0 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 6/73 (8%) Frame = -3 Query: 240 RNIIGFRKV-RGNVEFVRKVLAFVVYEDILKEHIRLFEARRVRWTVEWIAKR-----LVI 79 R IIG R + RGN VR + A + + EH+ L VR E I K+ +++ Sbjct: 63 RVIIGARNLDRGNAA-VRDIQASSGSQQVFVEHLDLASLSSVRKFAEVINKKEERVDILM 121 Query: 78 NNKGLKWCQIMAT 40 NN G+ W T Sbjct: 122 NNAGVAWIPFKRT 134 >SB_38059| Best HMM Match : Zfx_Zfy_act (HMM E-Value=2.6) Length = 722 Score = 29.1 bits (62), Expect = 1.0 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +2 Query: 92 LAIHSTVQRTRRASKSLICSLRMSSYTTKASTFLTNS 202 LA+ + RTRRA+KSL L+ S + + S LT S Sbjct: 443 LAVKQSSPRTRRANKSLQAPLKPPSSSPRPSKALTGS 479 >SB_31651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 827 Score = 27.9 bits (59), Expect = 2.4 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 6/71 (8%) Frame = -3 Query: 252 LLLFRNIIGFRKVRGNVEFVRKVLAFVVYEDILKEHIRL-----FEARRVRWTVEWIAK- 91 LLLF + FR V GN+ F + Y D++ R+ F + W + ++K Sbjct: 388 LLLFMRNLTFRGVTGNIRFEKSGNPTNAYYDVMNFRKRVPGGKYFIEKVGFWKRDQVSKP 447 Query: 90 RLVINNKGLKW 58 +L +N K ++W Sbjct: 448 QLQVNGKLIQW 458 >SB_44176| Best HMM Match : PAP_assoc (HMM E-Value=0.56) Length = 579 Score = 27.9 bits (59), Expect = 2.4 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 128 ASKSLICSLRMSSYTTKASTFLTNSTFPLTFLKPM 232 A K LIC+L S++ + S T PL++L PM Sbjct: 96 AFKVLICTLLFSAFRLERSPSTPPITAPLSYLPPM 130 >SB_12097| Best HMM Match : Birna_VP5 (HMM E-Value=4.6) Length = 383 Score = 27.9 bits (59), Expect = 2.4 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 89 LLAIHSTVQRTRRASKSLICSLRMSSYT---TKASTFLTNSTFP 211 L A H+T+ RTR S+S CSLR + + TK+ T+ T P Sbjct: 232 LYARHNTLTRTRAPSRS--CSLRTAQHPHTGTKSPMLSTHGTTP 273 >SB_11502| Best HMM Match : PA (HMM E-Value=9.3) Length = 511 Score = 27.9 bits (59), Expect = 2.4 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +1 Query: 19 FVYPFESSSHDLTPFEAFVIDNKPFGYPF 105 FVYPF++SS D T F ++I K G PF Sbjct: 154 FVYPFKTSSSD-TSFSTYII-MKGRGIPF 180 >SB_12922| Best HMM Match : MFS_1 (HMM E-Value=1.1) Length = 473 Score = 27.1 bits (57), Expect = 4.2 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 56 HHLRPLLL-ITSLLAIHSTVQRTRRASKSLICSLRMSSYTT 175 H+ PL+ IT+ + + T+ RTR A+ ++I S SY T Sbjct: 224 HNATPLVQSITAPTSPNVTINRTREANSTMILSSTSVSYNT 264 Score = 26.6 bits (56), Expect = 5.5 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 56 HHLRPLLL-ITSLLAIHSTVQRTRRASKSLICSLRMSSYTT 175 H+ PL+ IT+ + + T+ RTR A ++I S SY T Sbjct: 35 HNATPLVQSITAPTSPNVTINRTREAKSTMILSSTSVSYNT 75 Score = 26.6 bits (56), Expect = 5.5 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 56 HHLRPLLL-ITSLLAIHSTVQRTRRASKSLICSLRMSSYTT 175 H+ PL+ IT+ + + T+ RTR A ++I S SY T Sbjct: 413 HNATPLVQSITAPTSPNVTINRTREAKSTMILSSTSVSYNT 453 >SB_5822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 404 Score = 26.6 bits (56), Expect = 5.5 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 165 EDILKEHIRLFEARRVRWTVEW-IAKRLVINNKGLKWCQIMAT 40 E L +HI + RR+ +TV W I R +K K C + T Sbjct: 325 ETELSKHIWQLKDRRINYTVSWKIIARAKAYSKESKRCNLCTT 367 >SB_50861| Best HMM Match : Borrelia_orfA (HMM E-Value=4.4) Length = 373 Score = 25.8 bits (54), Expect = 9.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 46 HDLTPFEAFVIDNKPFGYPFDRPA 117 HDL + I+ +PF P DRP+ Sbjct: 315 HDLVVYGTVDIEGEPFLVPMDRPS 338 >SB_23067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 25.8 bits (54), Expect = 9.7 Identities = 9/23 (39%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = +1 Query: 160 VFVYHE--GEHFPYKFNVPPYFS 222 V+ HE G+HFP+ +++ PY++ Sbjct: 336 VYCGHEWLGKHFPFSWDLDPYYT 358 >SB_12636| Best HMM Match : PI-PLC-Y (HMM E-Value=1.2e-18) Length = 249 Score = 25.8 bits (54), Expect = 9.7 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = -3 Query: 249 LLFRNIIGFRKVRGNVEFV--RKVLAFVVYEDILKEHIRLFEARRVRWTVEWIAKRLVI 79 LLF+N+I +R V +V R +V L IR+ E + W V+ ++ ++ Sbjct: 189 LLFQNVISLESIREGVRYVPFRTPTGVLVSHSGLFVKIRVKEFAQASWKVKGTSRERLL 247 >SB_51089| Best HMM Match : I-set (HMM E-Value=1.4e-38) Length = 1334 Score = 25.8 bits (54), Expect = 9.7 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 203 LNL*GKCSPSWYTKTSLKNILGSLKHVESAGR 108 L++ +C PS+ KTS+++ L + V S GR Sbjct: 591 LDMWDRCKPSYLFKTSVRSGLRNCGDVNSIGR 622 >SB_21037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 25.8 bits (54), Expect = 9.7 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = -3 Query: 120 VRWTVEWIAKRLVINNKGLKWCQIMATRFKRIYENKELEW 1 ++W +I R ++ N +KW + ++ I N +EW Sbjct: 49 IKWLRCFIVWRGIVTNSAIKWLRCFIV-WRGIVTNSAIEW 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,595,219 Number of Sequences: 59808 Number of extensions: 176854 Number of successful extensions: 473 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 523129866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -