BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L04 (491 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55736| Best HMM Match : NACHT (HMM E-Value=3.2e-14) 27 8.4 SB_55278| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_28657| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 >SB_55736| Best HMM Match : NACHT (HMM E-Value=3.2e-14) Length = 696 Score = 27.1 bits (57), Expect = 8.4 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = +2 Query: 29 LEHYQTALTDPAFYMIWKRVLKMFSLLHQRLPEYKEEELALPDVAIQKVEVDKL 190 LE Y T M+ + V K L +++PEY E +A D+ + + L Sbjct: 347 LEFYHTVNRYDLAMMVGRNVAKAVESLARKVPEYPPERIATFDMDANSIALKLL 400 >SB_55278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 27.1 bits (57), Expect = 8.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 415 TTCQLREFLPAESLHSRIGCR 477 +TC + F+P S+H R+G R Sbjct: 321 STCDRQSFIPVHSIHERLGER 341 >SB_28657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3296 Score = 27.1 bits (57), Expect = 8.4 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 208 YLCEHQCVCSYERS 249 YLCE C C YER+ Sbjct: 1021 YLCEKLCACCYERA 1034 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,623,927 Number of Sequences: 59808 Number of extensions: 244701 Number of successful extensions: 447 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -