BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_L04 (491 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18080.1 68416.m02299 glycosyl hydrolase family 1 protein con... 28 3.0 At1g65230.1 68414.m07395 expressed protein 28 3.9 At5g61550.1 68418.m07724 protein kinase family protein contains ... 27 5.2 At3g18070.1 68416.m02298 glycosyl hydrolase family 1 protein con... 27 5.2 At2g34180.1 68415.m04183 CBL-interacting protein kinase 13 (CIPK... 27 6.9 At2g10440.1 68415.m01097 hypothetical protein 27 9.1 >At3g18080.1 68416.m02299 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to beta-glucosidase BGQ60 precursor GB:A57512 [Hordeum vulgare]; similar to beta-mannosidase enzyme (GI:17226270) [Lycopersicon esculentum] Length = 512 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/36 (30%), Positives = 24/36 (66%) Frame = +2 Query: 95 MFSLLHQRLPEYKEEELALPDVAIQKVEVDKLVTYY 202 M +++ +RLP++ E+E+ + +I V +++ TYY Sbjct: 316 MQNIVKERLPKFTEKEVKMVKGSIDFVGINQYTTYY 351 >At1g65230.1 68414.m07395 expressed protein Length = 286 Score = 27.9 bits (59), Expect = 3.9 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 101 SLLHQRLPEYKEEELALPDVAIQKVEVDKLVTYYEY 208 S +H RLP+ + +V+I K EVDKLV ++ Sbjct: 30 SKIHHRLPQVMNDSTRT-EVSIDKSEVDKLVDKIDF 64 >At5g61550.1 68418.m07724 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain; protein kinase 1, PnPK1, Populus nigra, EMBL:AB041503 Length = 845 Score = 27.5 bits (58), Expect = 5.2 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +2 Query: 89 LKMFSLLHQRLPEYKEEELALPDVAIQKVEVDKLVTYYEYTYVNISAS 232 L M LH+R E+K E A +Q V V Y YT+ I+A+ Sbjct: 439 LMMKEALHRREAEFKAERDAREKDKLQASLVSPGVQYQHYTWEEIAAA 486 >At3g18070.1 68416.m02298 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to beta-mannosidase enzyme (GI:17226270) [Lycopersicon esculentum] Length = 501 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/34 (29%), Positives = 23/34 (67%) Frame = +2 Query: 101 SLLHQRLPEYKEEELALPDVAIQKVEVDKLVTYY 202 +++ +RLP++ EEE+ + +I V +++ TY+ Sbjct: 307 NIVKERLPKFTEEEVKMVKGSIDFVGINQYTTYF 340 >At2g34180.1 68415.m04183 CBL-interacting protein kinase 13 (CIPK13) identical to CBL-interacting protein kinase 13 [Arabidopsis thaliana] gi|13249125|gb|AAK16688 Length = 502 Score = 27.1 bits (57), Expect = 6.9 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +2 Query: 158 VAIQKVEVDKLVTYYEYTYVNISASVHMNEVQSQLVYDKESVLVQQARLNHKKFNI 325 + + K E+ KL+ + + V ++ ++H E + V DKE + V+ H K I Sbjct: 52 ILMDKYEIGKLLGHGSFAKVYLARNIHSGEDVAIKVIDKEKI-VKSGLAGHIKREI 106 >At2g10440.1 68415.m01097 hypothetical protein Length = 935 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 89 LKMFSLLHQRLPEYKEEELALPDVAIQKVEVDKL 190 L + SL+HQR+ E E +LP +Q ++KL Sbjct: 326 LPVLSLMHQRVAEKLRETESLPPQPMQAQWIEKL 359 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,681,972 Number of Sequences: 28952 Number of extensions: 175610 Number of successful extensions: 365 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 858708096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -