BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K23 (593 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 36 7e-04 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 27 0.46 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 27 0.46 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 27 0.46 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 27 0.46 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 27 0.46 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 27 0.46 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 27 0.46 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 27 0.46 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 27 0.46 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 27 0.46 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 27 0.46 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 27 0.46 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 27 0.46 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 27 0.46 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 27 0.46 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 27 0.46 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 27 0.46 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 27 0.46 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 27 0.46 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 27 0.46 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 27 0.46 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 27 0.46 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 27 0.46 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 27 0.46 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 27 0.46 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 27 0.46 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 27 0.46 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 25 1.8 DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 24 3.2 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 23 7.4 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 7.4 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 7.4 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 23 7.4 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 23 7.4 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 9.8 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 36.3 bits (80), Expect = 7e-04 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 2/87 (2%) Frame = +1 Query: 19 DFSSVLDQHDTALVM--FYAPWCGHCKRLKPEYAVAAGILKKDDPPVSLAKVDCTEGGKS 192 DF++ L+ LV+ F+A WCG CK + P+ K + + KVD E + Sbjct: 10 DFNNKLEAAGDQLVVVDFFATWCGPCKVIAPK---LEEFQNKYADKIVVVKVDVDE-CEE 65 Query: 193 TCEKFSVSGYPTLKIFRKGELSSDYNG 273 +++++ PT ++ E+ ++G Sbjct: 66 LAAQYNIASMPTFLFIKRKEVVGQFSG 92 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 75 RHTPQIIMFYADWCFACMK 93 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 75 RHTPQIIMFYADWCFACMK 93 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 77 RHTPQIIMFYADWCFACMK 95 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 77 RHTPQIIMFYADWCFACMK 95 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 80 RHTPQIIMFYADWCFACMK 98 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 80 RHTPQIIMFYADWCFACMK 98 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 90 RHTPQIIMFYADWCFACMK 108 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 92 RHTPQIIMFYADWCFACMK 110 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 92 RHTPQIIMFYADWCFACMK 110 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 74 RHTPQIIMFYADWCFACMK 92 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 74 RHTPQIIMFYADWCFACMK 92 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 27.1 bits (57), Expect = 0.46 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 40 QHDTALVMFYAPWCGHCKR 96 +H ++MFYA WC C + Sbjct: 89 RHTPQIIMFYADWCFACMK 107 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 25.0 bits (52), Expect = 1.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 52 ALVMFYAPWCGHCKRLKPEY 111 A+V YAP C CK + Y Sbjct: 20 AMVFAYAPTCARCKSIGARY 39 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 24.2 bits (50), Expect = 3.2 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -1 Query: 548 RRLGRYNTTLFLYPTFSRTSLAEECPNVTSSLILSAVLRKSPLRSD 411 R GR + SR + ++ ++LS++LR+ LRSD Sbjct: 191 RSEGRSTNVFIPFSAGSRNCIGGRYAMLSMKVMLSSILRRLRLRSD 236 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.0 bits (47), Expect = 7.4 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -2 Query: 592 FRHRKQPKTLQTCSEDAWDGIIRHCSCIQPSQGPP 488 F+ K T S+ +DGI +QP GPP Sbjct: 411 FQEHKNKLPPYTRSQLTFDGISITGITVQPEDGPP 445 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 23.0 bits (47), Expect = 7.4 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +1 Query: 322 PSSRDLLTLADFEAFTAKDDVVVIGFFEKESDLKGDFLKTADK 450 PS + + FTA+ + V+ + + D KG+ TA K Sbjct: 36 PSHSNAAKMGSRRIFTAQFKLQVLDSYRNDGDCKGNQRATARK 78 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +1 Query: 151 VSLAKVDCTEGGKSTCEKFSVSGYPTLKIFRKGELS 258 + L +D +GG + + ++ T+ + R GEL+ Sbjct: 28 IKLEYIDLFKGGHLSSDYLKINPLHTVPVLRHGELT 63 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 23.0 bits (47), Expect = 7.4 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 145 PPVSLAKVDCTEGGKSTCEKFSVSGYPTL 231 P VSLA V G C S+S YPT+ Sbjct: 302 PTVSLAGVLGMLAGVLACTVESISYYPTI 330 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.0 bits (47), Expect = 7.4 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -2 Query: 592 FRHRKQPKTLQTCSEDAWDGIIRHCSCIQPSQGPP 488 F+ K T S+ +DGI +QP GPP Sbjct: 411 FQEHKNKLPPYTRSQLTFDGISITGITVQPEDGPP 445 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 22.6 bits (46), Expect = 9.8 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 272 VLGNQMALSSTCVPKLDPALEIYLLWLTLKHSPLRM 379 +LG Q +LS+ C+ LLWL K P+RM Sbjct: 396 MLGVQ-SLSALCLACWGVCSTFVLLWLINKVVPIRM 430 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.316 0.134 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 593,249 Number of Sequences: 2352 Number of extensions: 11425 Number of successful extensions: 77 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -