BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K22 (276 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y13620-1|CAA73942.1| 1394|Homo sapiens B-cell CLL/lymphoma 9 pro... 28 4.6 BC116451-1|AAI16452.1| 1426|Homo sapiens B-cell CLL/lymphoma 9 p... 28 4.6 AL359207-1|CAI15198.1| 1426|Homo sapiens B-cell CLL/lymphoma 9 p... 28 4.6 AL353807-3|CAI13211.2| 2964|Homo sapiens ash1 (absent, small, or... 28 4.6 AL353807-2|CAI13212.1| 2969|Homo sapiens ash1 (absent, small, or... 28 4.6 AL139410-7|CAI12716.2| 2964|Homo sapiens ash1 (absent, small, or... 28 4.6 AL139410-6|CAI12722.1| 2969|Homo sapiens ash1 (absent, small, or... 28 4.6 AK097637-1|BAC05127.1| 177|Homo sapiens protein ( Homo sapiens ... 28 4.6 AF257305-1|AAF68983.1| 2969|Homo sapiens ASH1 protein. 28 4.6 AB209068-1|BAD92305.1| 636|Homo sapiens ash1 (absent, small, or... 28 4.6 AB037841-1|BAA92658.1| 1349|Homo sapiens KIAA1420 protein protein. 28 4.6 AL138762-3|CAH70950.1| 1173|Homo sapiens chromosome 10 open read... 27 8.0 AL138762-2|CAH70949.1| 1186|Homo sapiens chromosome 10 open read... 27 8.0 AL133215-19|CAI10933.1| 1173|Homo sapiens chromosome 10 open rea... 27 8.0 AL133215-18|CAI10932.1| 1186|Homo sapiens chromosome 10 open rea... 27 8.0 AK001374-1|BAA91657.1| 498|Homo sapiens protein ( Homo sapiens ... 27 8.0 AF460991-1|AAN84475.1| 1173|Homo sapiens C10ORF6 protein. 27 8.0 >Y13620-1|CAA73942.1| 1394|Homo sapiens B-cell CLL/lymphoma 9 protein. Length = 1394 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +2 Query: 77 NRVPSDG-NSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFN--HPNYPP 229 N +P G N+ + I+ P+P P+ P G +P+S N PN PP Sbjct: 1051 NNMPGMGINTQNPRISGPNPVVPMPTLSPMGMTQPLSHSNQMPSPNAVGPNIPP 1104 >BC116451-1|AAI16452.1| 1426|Homo sapiens B-cell CLL/lymphoma 9 protein. Length = 1426 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +2 Query: 77 NRVPSDG-NSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFN--HPNYPP 229 N +P G N+ + I+ P+P P+ P G +P+S N PN PP Sbjct: 1051 NNMPGMGINTQNPRISGPNPVVPMPTLSPMGMTQPLSHSNQMPSPNAVGPNIPP 1104 >AL359207-1|CAI15198.1| 1426|Homo sapiens B-cell CLL/lymphoma 9 protein. Length = 1426 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +2 Query: 77 NRVPSDG-NSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFN--HPNYPP 229 N +P G N+ + I+ P+P P+ P G +P+S N PN PP Sbjct: 1051 NNMPGMGINTQNPRISGPNPVVPMPTLSPMGMTQPLSHSNQMPSPNAVGPNIPP 1104 >AL353807-3|CAI13211.2| 2964|Homo sapiens ash1 (absent, small, or homeotic)-like (Drosophila) protein. Length = 2964 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 83 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 205 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1093 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1129 >AL353807-2|CAI13212.1| 2969|Homo sapiens ash1 (absent, small, or homeotic)-like (Drosophila) protein. Length = 2969 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 83 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 205 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1093 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1129 >AL139410-7|CAI12716.2| 2964|Homo sapiens ash1 (absent, small, or homeotic)-like (Drosophila) protein. Length = 2964 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 83 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 205 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1093 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1129 >AL139410-6|CAI12722.1| 2969|Homo sapiens ash1 (absent, small, or homeotic)-like (Drosophila) protein. Length = 2969 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 83 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 205 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1093 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1129 >AK097637-1|BAC05127.1| 177|Homo sapiens protein ( Homo sapiens cDNA FLJ40318 fis, clone TESTI2030556. ). Length = 177 Score = 28.3 bits (60), Expect = 4.6 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 33 LSCFSSSPYWPWLPQTEF 86 L+CF P+WP++PQT F Sbjct: 72 LACFLQ-PWWPFIPQTRF 88 >AF257305-1|AAF68983.1| 2969|Homo sapiens ASH1 protein. Length = 2969 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 83 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 205 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1093 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1129 >AB209068-1|BAD92305.1| 636|Homo sapiens ash1 (absent, small, or homeotic)-like variant protein. Length = 636 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 83 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 205 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 384 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 420 >AB037841-1|BAA92658.1| 1349|Homo sapiens KIAA1420 protein protein. Length = 1349 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 83 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 205 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1097 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1133 >AL138762-3|CAH70950.1| 1173|Homo sapiens chromosome 10 open reading frame 6 protein. Length = 1173 Score = 27.5 bits (58), Expect = 8.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 42 FSSSPYWPWLP 74 FS SP WPW+P Sbjct: 840 FSDSPVWPWIP 850 >AL138762-2|CAH70949.1| 1186|Homo sapiens chromosome 10 open reading frame 6 protein. Length = 1186 Score = 27.5 bits (58), Expect = 8.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 42 FSSSPYWPWLP 74 FS SP WPW+P Sbjct: 840 FSDSPVWPWIP 850 >AL133215-19|CAI10933.1| 1173|Homo sapiens chromosome 10 open reading frame 6 protein. Length = 1173 Score = 27.5 bits (58), Expect = 8.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 42 FSSSPYWPWLP 74 FS SP WPW+P Sbjct: 840 FSDSPVWPWIP 850 >AL133215-18|CAI10932.1| 1186|Homo sapiens chromosome 10 open reading frame 6 protein. Length = 1186 Score = 27.5 bits (58), Expect = 8.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 42 FSSSPYWPWLP 74 FS SP WPW+P Sbjct: 840 FSDSPVWPWIP 850 >AK001374-1|BAA91657.1| 498|Homo sapiens protein ( Homo sapiens cDNA FLJ10512 fis, clone NT2RP2000658. ). Length = 498 Score = 27.5 bits (58), Expect = 8.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 42 FSSSPYWPWLP 74 FS SP WPW+P Sbjct: 165 FSDSPVWPWIP 175 >AF460991-1|AAN84475.1| 1173|Homo sapiens C10ORF6 protein. Length = 1173 Score = 27.5 bits (58), Expect = 8.0 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 42 FSSSPYWPWLP 74 FS SP WPW+P Sbjct: 840 FSDSPVWPWIP 850 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,436,470 Number of Sequences: 237096 Number of extensions: 790025 Number of successful extensions: 1768 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1768 length of database: 76,859,062 effective HSP length: 69 effective length of database: 60,499,438 effective search space used: 1330987636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -