BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K22 (276 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 21 2.8 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 2.8 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 20 6.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 19 8.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 19 8.6 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 21.0 bits (42), Expect = 2.8 Identities = 14/56 (25%), Positives = 22/56 (39%) Frame = +2 Query: 95 GNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDXPLARGG 262 GN+ + I P P + EP + P ++ P +P R + P A G Sbjct: 71 GNNRPIYIPQPRPPHPRLRREAESEAEPGNNRPVYIPQPRPPHPRLRRE-PEAEPG 125 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.0 bits (42), Expect = 2.8 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = +2 Query: 128 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRY 238 DP+F + ++ ++ +D NHP + K Y Sbjct: 171 DPWFPRHASDLDNCNHLMTKFEPDLDMNHPGFADKEY 207 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 19.8 bits (39), Expect = 6.5 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = +1 Query: 250 RPWWE 264 RPWWE Sbjct: 74 RPWWE 78 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 19.4 bits (38), Expect = 8.6 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +1 Query: 211 SSQLSTQAIRXPSRPWWE 264 S+ L+ A+ P+R W++ Sbjct: 1330 SATLACNAVGDPTREWYK 1347 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 19.4 bits (38), Expect = 8.6 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +1 Query: 211 SSQLSTQAIRXPSRPWWE 264 S+ L+ A+ P+R W++ Sbjct: 1326 SATLACNAVGDPTREWYK 1343 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,306 Number of Sequences: 438 Number of extensions: 1619 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 48 effective length of database: 125,319 effective search space used: 5388717 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -