BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K20 (637 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21167| Best HMM Match : KH_1 (HMM E-Value=0) 81 6e-16 SB_24937| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1284| Best HMM Match : KH_1 (HMM E-Value=1.2e-07) 33 0.19 SB_27288| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_11594| Best HMM Match : F5_F8_type_C (HMM E-Value=4.4e-35) 30 1.4 SB_9694| Best HMM Match : IclR (HMM E-Value=5) 30 1.8 SB_7910| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50528| Best HMM Match : Flavi_propep (HMM E-Value=8.5) 29 2.4 SB_50053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) 29 2.4 SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.2 SB_42869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_45106| Best HMM Match : Adeno_E3B (HMM E-Value=1.1) 27 9.7 SB_5196| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_38744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_21167| Best HMM Match : KH_1 (HMM E-Value=0) Length = 1650 Score = 81.4 bits (192), Expect = 6e-16 Identities = 38/82 (46%), Positives = 60/82 (73%), Gaps = 1/82 (1%) Frame = +3 Query: 129 DNQCKEEVDIDPRVHRRLIGLRGKNIRRIMDEFKVDIRFPK-HGDDSVXGXITGDEDNVL 305 ++Q E+ IDPR+HRRLIG +G+ +R++M+++KVDIRFP+ + +D V I+G E +V Sbjct: 1110 EDQVSVELTIDPRIHRRLIGAKGRAVRKLMEQYKVDIRFPRQNANDPV--VISGQEQDVE 1167 Query: 306 DAKDHLLNLAEEYLQDVADRYQ 371 +AK+ LL L EEY+Q V + + Sbjct: 1168 EAKEQLLLLEEEYMQSVKEEIE 1189 Score = 50.4 bits (115), Expect = 1e-06 Identities = 31/84 (36%), Positives = 45/84 (53%) Frame = +3 Query: 51 DIITIQGYEEKALQAKDAIMAIVHQLDNQCKEEVDIDPRVHRRLIGLRGKNIRRIMDEFK 230 DII I G +E A AK ++ +V E++ I HR +IG +G N+R++MDEF Sbjct: 893 DIIIITGKKESAEAAKIDLLDLV-----PVTEQMHIPFDYHRFVIGPKGSNVRKMMDEFS 947 Query: 231 VDIRFPKHGDDSVXGXITGDEDNV 302 V+I P D+S + G NV Sbjct: 948 VNISIPPAKDESDSVSVIGPRANV 971 Score = 47.6 bits (108), Expect = 8e-06 Identities = 33/108 (30%), Positives = 52/108 (48%), Gaps = 2/108 (1%) Frame = +3 Query: 9 GVQINLPKRGEPDDDIITIQGYEEKALQAKDAIMAIVHQLD-NQCKEEVDIDPRVHRRLI 185 GV I P G D ++ I+G ++ +AK ++ + ++ + E+ P HR LI Sbjct: 691 GVSIKFPPEGSNSDKVL-IRGPKDDVEKAKKQLLELTNEKELGSYTVEIRAKPEHHRFLI 749 Query: 186 GLRGKNIRRIMDEFKVDIRFPKHGD-DSVXGXITGDEDNVLDAKDHLL 326 G G +IR++ + I FP D D I G ++ V AKD LL Sbjct: 750 GRGGASIRKVRENTGARIVFPAAKDEDKELITIIGKQEAVEAAKDELL 797 Score = 44.4 bits (100), Expect = 8e-05 Identities = 21/78 (26%), Positives = 38/78 (48%) Frame = +3 Query: 69 GYEEKALQAKDAIMAIVHQLDNQCKEEVDIDPRVHRRLIGLRGKNIRRIMDEFKVDIRFP 248 G +E A+ +M IV +L++ E I HR ++G +G N++ + KV I+FP Sbjct: 804 GAKECVEGARQRVMEIVQELESMVTIECVIPQEFHRNIMGAKGANVQEVTARHKVQIKFP 863 Query: 249 KHGDDSVXGXITGDEDNV 302 + GD +++ Sbjct: 864 DRSPAGEEPVVNGDGEHL 881 Score = 44.0 bits (99), Expect = 1e-04 Identities = 34/128 (26%), Positives = 71/128 (55%), Gaps = 12/128 (9%) Frame = +3 Query: 3 DFGVQINLPKRGEPDDDIITI--QGYEEKALQAKDAIMAIVHQLDNQ------CKEEVDI 158 +F V I++P + D + I + E+A++A +A +A + + +N+ K +V + Sbjct: 945 EFSVNISIPPAKDESDSVSVIGPRANVERAMKALEAKVAEI-EAENEDRALRSFKMDVKV 1003 Query: 159 DPRVHRRLIGLRGKNIRRIMDEFKVDIRFPKHG--DDS--VXGXITGDEDNVLDAKDHLL 326 D + H ++IG +G+ I I ++ V+I+FP ++S V G +TG + + A+D +L Sbjct: 1004 DRQYHPKIIGRKGQVITNIRKQYDVNIQFPPQDAPEESADVIG-LTGYQHSCEAARDAIL 1062 Query: 327 NLAEEYLQ 350 + +E ++ Sbjct: 1063 KIVKELVR 1070 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/118 (25%), Positives = 57/118 (48%), Gaps = 1/118 (0%) Frame = +3 Query: 9 GVQINLPKRGEPDDDIITIQGYEEKALQAKDAIMAIVHQLDNQCKEEVDIDPRVHRRLIG 188 GV + +P + D + IT++G ++K A+ + + ++ EV +HR +IG Sbjct: 368 GVSVEMPP-SDSDSETITLRGEQDKL---GVALTQVYEKANSVVFAEVAAPRWLHRFIIG 423 Query: 189 LRGKNIRRIMDEF-KVDIRFPKHGDDSVXGXITGDEDNVLDAKDHLLNLAEEYLQDVA 359 RG+NIR++ + KV + F D+ + G + V A++ L E + +A Sbjct: 424 RRGQNIRKVTQDLPKVHVEF---SDEKDSITLEGPPEQVESARESLEAFIRELIVSMA 478 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/65 (32%), Positives = 33/65 (50%) Frame = +3 Query: 147 EVDIDPRVHRRLIGLRGKNIRRIMDEFKVDIRFPKHGDDSVXGXITGDEDNVLDAKDHLL 326 +V I + H+ +IG G I++I +E I P G DS ITG + V A++ +L Sbjct: 591 DVPIFKQFHKNVIGRGGTTIKKIREETDTKIELPAEGSDSDVIIITGHKAQVEAAREKIL 650 Query: 327 NLAEE 341 + E Sbjct: 651 AIQNE 655 >SB_24937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 589 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/67 (26%), Positives = 34/67 (50%) Frame = +3 Query: 48 DDIITIQGYEEKALQAKDAIMAIVHQLDNQCKEEVDIDPRVHRRLIGLRGKNIRRIMDEF 227 D I + G + AK+ +MA++ ++ ++D+ H +IG G NI+++M + Sbjct: 312 DPHIKVAGLPDSVRMAKEKVMAVLDTKSSRVTLKMDVSHTDHSHIIGKGGYNIKKVMQDT 371 Query: 228 KVDIRFP 248 I FP Sbjct: 372 GCHIHFP 378 Score = 34.3 bits (75), Expect = 0.084 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +3 Query: 147 EVDIDPRVHRRLIGLRGKNIRRIMDEFKVDIRFPKHGDDSVXGXI--TGDEDNVLDAKDH 320 ++DI P+ H +IG G NI+ I + + FP G + +G ++V+ A+ Sbjct: 473 QIDIAPQHHLFIIGKNGANIKHITQQTGASVNFPDPNGTQRKGVVFLSGSVESVICARAQ 532 Query: 321 LLN 329 LL+ Sbjct: 533 LLD 535 >SB_1284| Best HMM Match : KH_1 (HMM E-Value=1.2e-07) Length = 333 Score = 33.1 bits (72), Expect = 0.19 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 4/94 (4%) Frame = +3 Query: 72 YEEKALQAKDAI---MAIVHQLDNQCKEEVDIDPRVHRRLIGLRGKNIRRIMDEFKVDIR 242 YE++ L +D + + +V N K + I VHR +IG +G R+I + I Sbjct: 43 YEQEDLTYEDEVCDALNLVESTANGFKSSMGISCEVHRFIIGYKGNTKRQIEQDTNTRIS 102 Query: 243 FPKHGDDSVXGXITG-DEDNVLDAKDHLLNLAEE 341 P+ G ITG + VL A+ H +++ E Sbjct: 103 IPRVGQTGDI-VITGQSKAEVLSAR-HKVDIVVE 134 >SB_27288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 31.9 bits (69), Expect = 0.45 Identities = 20/58 (34%), Positives = 28/58 (48%) Frame = +3 Query: 42 PDDDIITIQGYEEKALQAKDAIMAIVHQLDNQCKEEVDIDPRVHRRLIGLRGKNIRRI 215 P + I I+G EKA +A+ I IV + Q EE I ++IG G IR + Sbjct: 108 PSERTIVIKGEREKARKAELIIKKIVAEQPRQLTEEYLIPQAACGKIIGRGGATIRHL 165 >SB_11594| Best HMM Match : F5_F8_type_C (HMM E-Value=4.4e-35) Length = 1814 Score = 30.3 bits (65), Expect = 1.4 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 3/85 (3%) Frame = +3 Query: 255 GDDSVXGXITGDED-NVLDA-KDHLLNLAEEYLQDVA-DRYQAPAAPSLADFGSVLNENS 425 G D V G GD D + L K H L+ E + VA + A+P LA F + Sbjct: 57 GVDGVLGGEMGDLDVHFLHVVKKHFLSRVETGFKKVALIIVRISASPDLALFSDIQEITI 116 Query: 426 STGSVERTRIPERLLLLVLW*KGVR 500 +G+++ + E LLL + +G+R Sbjct: 117 FSGNIDNMSVKENLLLPPVVARGIR 141 >SB_9694| Best HMM Match : IclR (HMM E-Value=5) Length = 282 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = +3 Query: 261 DSVXGXITGDEDNVLDAKDHLLNLAEEYLQDVADRYQAPAAPSLADFGSVLNENSSTG 434 D+V D+DN ++ +H+ N+ E+ LQ + R L DF + + S G Sbjct: 171 DNVSNQDDDDDDNDTESVEHIFNMVEDTLQSLTQRM---IKSELEDFELIADGGSCNG 225 >SB_7910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 419 Score = 29.9 bits (64), Expect = 1.8 Identities = 22/66 (33%), Positives = 31/66 (46%) Frame = +3 Query: 21 NLPKRGEPDDDIITIQGYEEKALQAKDAIMAIVHQLDNQCKEEVDIDPRVHRRLIGLRGK 200 N+P RG ++D + E+ + A D + L N K I PR+ LI L GK Sbjct: 160 NIPLRGHTEEDS-NFKIILER-IAASDRTLG--DHLANARKNATYISPRIQNELIELCGK 215 Query: 201 NIRRIM 218 NIR + Sbjct: 216 NIRNTL 221 >SB_50528| Best HMM Match : Flavi_propep (HMM E-Value=8.5) Length = 358 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +3 Query: 237 IRFPKHGDDSVXGXITGDE----DNVLDAKDHLLNLAEEYLQDVADRYQAPAAPS 389 +RF +HGD+S +E N+L DHLLN + L+ D A A PS Sbjct: 286 VRFARHGDESSIVVRDREEAAYLTNLLAGTDHLLNF--DVLRVCTDAIYAKAVPS 338 >SB_50053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 959 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +3 Query: 117 VHQLDNQCKEEVDIDPRVHR-RLIGLRGKNIRRIMDEFKVDIRFPKHGDDSVXGXITG 287 ++Q D K ++++D + + +G G N+ +I+ EF PK D+ + G ++G Sbjct: 121 IYQKDEHLKLKMEVDSDNNEVKQLG-NGNNMEKILREFIKKKNMPKREDEKLQGNVSG 177 >SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) Length = 358 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Frame = -2 Query: 318 DP*HRARCLHHP*SXHXRYHHHV---SGNVCPP*TRP*YDVYSFPSTQSVFYEH 166 DP R HH H +HHH V PP T Y + +PS+ + + H Sbjct: 127 DPTGNHRHYHHHYHHHHHHHHHFVQPPYQVPPPPTPQPYHPHPYPSSGPMHHRH 180 >SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 339 PRPGSRGDP*HRARCLHHP*SXHXRYHHH 253 P G GDP H A L + R+HHH Sbjct: 258 PFVGDNGDPIHMAEALSQTNHLYHRHHHH 286 >SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1080 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 357 LRLASIPRPGSRGDP*HRARCLH 289 L LAS PGSRG P H+ R H Sbjct: 55 LHLASTTAPGSRGKPNHKGRRRH 77 >SB_42869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 500 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Frame = +3 Query: 147 EVDIDPRVHRRLIGLRGKNIRRIMDEFKVDIRFPKHGDDSVXG----XITGDEDNVLDAK 314 E++ + RLIG +GKN++ I D+ IR V ++GD + A Sbjct: 183 EIEFPQILCGRLIGRKGKNVKAISDQSGAKIRLIPQSPGEVSTHRIISLSGDSSQIKSAL 242 Query: 315 DHL 323 D + Sbjct: 243 DSI 245 >SB_45106| Best HMM Match : Adeno_E3B (HMM E-Value=1.1) Length = 234 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +1 Query: 343 TCKT*PIVTKRQPRRLSLTSVVF*TKTLVPAA 438 TC P++ KR P+RL++ +++F TLV +A Sbjct: 76 TCCRRPVIRKR-PKRLAILAILFCLSTLVCSA 106 >SB_5196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 412 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 537 SCVEAVSGARCSHGPPFTTKPATAGVPVFAFAPR 436 +C + S +R + PP ++PATA PVF P+ Sbjct: 303 ACHSSPSISRPATAPPSISRPATAPPPVFRGLPQ 336 >SB_38744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 345 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/88 (20%), Positives = 34/88 (38%) Frame = -3 Query: 401 EVSERRRGWRLVTIGYVLQVFLGQVQEVILSIEHVVFITRDXXTNAIITMFRETYVHLEL 222 +V E W +VT + + F+ + +++ +I +VFI + V Sbjct: 254 QVYESFNDWEMVTSSVLGEFFVSNLPQLVATINPLVFICLTKDLRRFARSGCQCLVIRRR 313 Query: 221 VHNTTYILSPQPNQSSMNTGININFFFA 138 H+ + PN + +G N FA Sbjct: 314 GHDRVTLTETYPNSTQYTSGYPSNGDFA 341 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,374,584 Number of Sequences: 59808 Number of extensions: 372728 Number of successful extensions: 1261 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1255 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -