BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K20 (637 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 25 1.5 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 25 2.7 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 3.5 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 24 3.5 AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-tran... 23 6.1 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 8.1 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 25.4 bits (53), Expect = 1.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 472 CWFCGERGSVGATCT 516 C+ C ERG + ATCT Sbjct: 466 CFRCLERGHIAATCT 480 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 24.6 bits (51), Expect = 2.7 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +3 Query: 153 DIDPRVHRRLIGLRGKNIRRIMDE-FKVD 236 D+DP +HR L + NI I+D F V+ Sbjct: 639 DVDPDLHRSLTWILENNITGIIDSTFSVE 667 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 24.2 bits (50), Expect = 3.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 9 GVQINLPKRGEPDDDIITIQGYEEKALQAKDAIM 110 GVQ+N RG +++ITI E AL +D ++ Sbjct: 720 GVQLNSLNRGPGAENVITIA--ETSALDQEDLLL 751 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 24.2 bits (50), Expect = 3.5 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = -3 Query: 512 HVAPTDPLSPQNQQQQAFRYSRSLHAAGTRVFVQNTTEVSERRRGWRLVTI 360 H+ T LS Q FR RS A TRV + ++R+G RL + Sbjct: 514 HLESTGGLS---DPQYGFRKGRSTVDAITRVMNNGKVALDKKRKGDRLCAV 561 >AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-transferase u1 protein. Length = 233 Score = 23.4 bits (48), Expect = 6.1 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 312 KDHLLNLA-EEYLQDVADRYQAPAAPSLADF 401 K HL A E YLQ RY A + ++ADF Sbjct: 129 KLHLALAAFETYLQRTGTRYAAGSGLTIADF 159 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 500 TDPLSPQNQQQQAFRYSRS 444 TDP+ P+N QQ R + S Sbjct: 974 TDPVRPENLQQHLLRDAES 992 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 606,287 Number of Sequences: 2352 Number of extensions: 12918 Number of successful extensions: 38 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -