BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_K18 (700 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19B12.02c |||1,3-beta-glucanosyltransferase|Schizosaccharomy... 28 1.1 SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pom... 27 2.6 SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual 27 3.4 SPBC13G1.04c |||alkB homolog|Schizosaccharomyces pombe|chr 2|||M... 27 3.4 SPBC4F6.16c |ero11||ER oxidoreductin Ero1a|Schizosaccharomyces p... 27 3.4 SPBC800.02 |whi5|mug54|cell cycle transcriptional repressor Whi5... 26 4.5 SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyc... 26 4.5 SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |S... 26 4.5 SPAC4F10.04 |||protein phosphatase type 2A, intrinsic regulator ... 26 6.0 SPAC1783.07c |pap1|caf3, caf3|transcription factor Caf3|Schizosa... 25 7.9 SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|ch... 25 7.9 SPAC18B11.05 |gpi18||pig-V|Schizosaccharomyces pombe|chr 1|||Manual 25 7.9 SPBC83.03c |tas3||RITS complex subunit 3 |Schizosaccharomyces po... 25 7.9 >SPAC19B12.02c |||1,3-beta-glucanosyltransferase|Schizosaccharomyces pombe|chr 1|||Manual Length = 542 Score = 28.3 bits (60), Expect = 1.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 577 ICKWKDSTRSCVIRELQSFGQYAKFHRY 494 +C+ DSTRSCVI + S Y+ Y Sbjct: 366 VCECMDSTRSCVINDDVSSDDYSDLFSY 393 >SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pombe|chr 1|||Manual Length = 986 Score = 27.1 bits (57), Expect = 2.6 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 448 GYAIPPIYEVLPEYFNNGEILHTAQRI 528 GY +PP+Y++ + + E+L +Q I Sbjct: 666 GYVLPPVYKITQIHSGDTELLQLSQEI 692 >SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 978 Score = 26.6 bits (56), Expect = 3.4 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = +1 Query: 49 DPVRTDDSVEFAKKQIDISLLYFHAREPNHVSKSITISASWSIENNINHYKNETAVKI 222 D +R +D + ++ L Y +A+ V + + A W NIN NE + + Sbjct: 178 DAIRANDMSDIVSFVYEMMLAYSNAKNYGTVGLCLQVYAQWVSWININLIVNEPCMNL 235 >SPBC13G1.04c |||alkB homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 26.6 bits (56), Expect = 3.4 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +1 Query: 592 VIRSNTTVWHYHCQSASMSYYLPDYSLNAH 681 V++ +T H+ ++A +++Y P +L+AH Sbjct: 171 VVKESTDFLHWKAEAAIVNFYSPGDTLSAH 200 >SPBC4F6.16c |ero11||ER oxidoreductin Ero1a|Schizosaccharomyces pombe|chr 2|||Manual Length = 467 Score = 26.6 bits (56), Expect = 3.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 119 WKYNKEISICFFANST 72 WKYN ++ C+ NST Sbjct: 116 WKYNPDLDYCYLDNST 131 >SPBC800.02 |whi5|mug54|cell cycle transcriptional repressor Whi5|Schizosaccharomyces pombe|chr 2|||Manual Length = 252 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 80 NSTESSVLTGSHNPGAKMSANTNKLK 3 N +SS L H+P + M +NT KL+ Sbjct: 88 NDLDSSKLRRPHHPNSIMGSNTGKLR 113 >SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyces pombe|chr 3|||Manual Length = 430 Score = 26.2 bits (55), Expect = 4.5 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -1 Query: 577 ICKWKDSTRSCVIRELQSFGQYAKFHRY*NI--PVKPHILEE*RNLLSQNDEC 425 IC W T+S E + AK+HR+ +I V+ H E L S +D+C Sbjct: 207 ICLWDVQTQSFTSSETKVISPIAKYHRHTDIVNDVQFHPQHE-ALLASVSDDC 258 >SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 971 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 55 VRTDDSVEFAKKQIDISLLYF 117 ++ D +V+ +KKQI SLLYF Sbjct: 262 IKKDSNVKCSKKQILFSLLYF 282 >SPAC4F10.04 |||protein phosphatase type 2A, intrinsic regulator |Schizosaccharomyces pombe|chr 1|||Manual Length = 325 Score = 25.8 bits (54), Expect = 6.0 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +3 Query: 75 RVREKADRYFLIILPCSRTKSRFEIYNYF 161 ++R+ A + II+P S +K++ E+ +YF Sbjct: 110 KLRDSASQIMDIIIPDSLSKAKVELLDYF 138 >SPAC1783.07c |pap1|caf3, caf3|transcription factor Caf3|Schizosaccharomyces pombe|chr 1|||Manual Length = 552 Score = 25.4 bits (53), Expect = 7.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 516 CPKDWSSRITHDRVLSFHL 572 CPK WS I H R SF + Sbjct: 501 CPKVWSKIINHPRFESFDI 519 >SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 445 Score = 25.4 bits (53), Expect = 7.9 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +1 Query: 67 DSVEFAKKQIDISLLYFHAREPNHVSKSITISASWSIENNINHYKNETAVK 219 +S+ K + S+L + A++ N+ + S+ WSI N + Y+N +K Sbjct: 98 NSIHNQLKDLSSSILSY-AQDCNYPFSQMPSSSQWSIVRNSSWYENLKLLK 147 >SPAC18B11.05 |gpi18||pig-V|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 25.4 bits (53), Expect = 7.9 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 553 EYYPSTYKWDNSVVIRSNTTVW 618 + YP+ + W + +IRSN W Sbjct: 205 QQYPAAFLWSLATLIRSNGIFW 226 >SPBC83.03c |tas3||RITS complex subunit 3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 549 Score = 25.4 bits (53), Expect = 7.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 160 SASWSIENNINHYKNETAVKI 222 + SWS ++ HYKNE A I Sbjct: 276 NGSWSSTDDTKHYKNEWAESI 296 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,985,321 Number of Sequences: 5004 Number of extensions: 65165 Number of successful extensions: 174 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -